SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Equus caballus 76_2 > ENSECAP00000016702

Domain assignment for ENSECAP00000016702 from Equus caballus 76_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSECAP00000016702
Domain Number 1	Region: 17-53
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000122
Family	LDL receptor-like module	0.0012
Further Details:

Domain Number 2	Region: 58-95
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000432
Family	LDL receptor-like module	0.0015
Further Details:

Domain Number 3	Region: 98-135
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000497
Family	LDL receptor-like module	0.0012
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSECAP00000016702 Gene: ENSECAG00000019236 Transcript: ENSECAT00000020348
Sequence length	333
Comment	pep:known_by_projection chromosome:EquCab2:12:2562777:2747106:1 gene:ENSECAG00000019236 transcript:ENSECAT00000020348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	SPAEGQLLPGNNFTNECNIPGNFMCGNGRCVPGAWQCDGLPDCFDGSDEKECPKAKSKCG PTFFPCASGVHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFIC DGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLAL VLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCSVTYNVNNGIQYVASQAEQNASD VGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSANSASSQAASSLL STEEAGHSPGQPGPREGAAEPRDSVPSQGPEEV
Download sequence
Identical sequences	F7AD24 ENSECAP00000016702 9796.ENSECAP00000016702 ENSECAP00000016702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]