SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016726 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016726
Domain Number 1 Region: 62-123
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 209-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 25-77
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000486
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016726   Gene: ENSECAG00000018935   Transcript: ENSECAT00000020380
Sequence length 412
Comment pep:known_by_projection chromosome:EquCab2:X:30739011:30779597:-1 gene:ENSECAG00000018935 transcript:ENSECAT00000020380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTPWCSPIKVKYGDVYCRAPPGGYYKTALGTRCDIRCRKGYELHGSSQLVCQSNKRWSDK
VICKQKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGQPA
SCVDMEPPRIKCPSVKERIAEPNKLTVRVSWETPEGRDTADGILTDVILKGLPPGSNFPE
GDHKIQYTVYDRAENKGVCKFRVKVRVRRCGKLNAPENGYMKCSSDGDNYGATCEFSCIG
GYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAALLDQFYEKRRLLIVSTPTARN
LLYRLQLGMLQQAQCGLDLRHITVVELVGVFPTLIGRIGAKIMPPALALQLRLLLRIPLY
SFSMVLVDKHGMDKERYVSLVMPVALFNLIDTFPLRKEEMVLQAEMGQTCNT
Download sequence
Identical sequences F7AC64
9796.ENSECAP00000016726 ENSECAP00000016726 ENSECAP00000016726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]