SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016862 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016862
Domain Number 1 Region: 695-958
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-66
Family Protein kinases, catalytic subunit 0.0000112
Further Details:      
 
Domain Number 2 Region: 373-660
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-48
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 3 Region: 230-354
Classification Level Classification E-value
Superfamily SH2 domain 1.96e-16
Family SH2 domain 0.0028
Further Details:      
 
Domain Number 4 Region: 1-89
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000262
Family Second domain of FERM 0.0043
Further Details:      
 
Domain Number 5 Region: 174-234
Classification Level Classification E-value
Superfamily PH domain-like 0.0000016
Family Third domain of FERM 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016862   Gene: ENSECAG00000018673   Transcript: ENSECAT00000020537
Sequence length 966
Comment pep:known_by_projection chromosome:EquCab2:5:95689196:95725590:1 gene:ENSECAG00000018673 transcript:ENSECAT00000020537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRINNVFKDFLKEF
NNKTICDSSVSMHDLKVKYLATLETLTKHYGAEIFETSELLISSENEMNRFHLNDSGNIL
YYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKYKKDEEKNKIREEWNNFSYFPE
ITHVVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAHHYLCTDVAPPL
IVHNIQNGCHGPICTEYAINKLRQEGGEEGMYVLRWSCTDFDNILMTVTCFEKSEVLGGQ
KQFKNFQIEVQKGCYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLKRCCQPKPREIS
NLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQGEHLGRGTRTHIYSGTLVDYRDDEGTP
EEKRIKVILKVLDPSHRDISLASAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFV
EGGPLDLFMHRKSDVLTTPWKFNVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSE
CGPFIKLSDPGIPITVLSRQERLERIPWIAPECVDDSKNLSVAADKWSFGTTLWEICYNG
EIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEE
QNPDIVSERKPAAEVDPTHFEKRFLKRIRDLGEATGHFGKVELCRYDPEGDNTGEQVAVK
SLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYL
PKNKNKINLKQQLKYAVQICKGMDYLGSQQYVHRDLAARNVLVESEHQVKIGDFGLTKAI
ERDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDSSPMALF
LKMIGPTHGQMTVTRLVNTLKEGKRLPCPPHCPDEVYQLMRKCWEFQPSSRTTFQNLIEG
FEALLK
Download sequence
Identical sequences F7BLF9
ENSECAP00000016862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]