SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016920 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016920
Domain Number 1 Region: 32-87
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00025
Further Details:      
 
Domain Number 2 Region: 151-206
Classification Level Classification E-value
Superfamily BPTI-like 1.15e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0017
Further Details:      
 
Domain Number 3 Region: 92-148
Classification Level Classification E-value
Superfamily BPTI-like 8.66e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016920   Gene: ENSECAG00000019398   Transcript: ENSECAT00000020601
Sequence length 208
Comment pep:known_by_projection chromosome:EquCab2:4:37493086:37497050:-1 gene:ENSECAG00000019398 transcript:ENSECAT00000020601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAHPLGLLLLPLLLMGTVLGAAAQVPSGNNAEICLLPPDEGPCRARIPSYYYDRYTQS
CRQFIYGGCEGNANNFETWAACDEACWRIEKVPKICRLEVSEGQCGEPRKQYFFNLSSMT
CEKFISGGCHSNENQFPDEATCMGFCAPKKSPSFCYSPKDEGLCSANVTRYYFNPRHKAC
EAFTYTGCGGNDNNFVNRKDCKQVCAKA
Download sequence
Identical sequences F6V7B1
ENSECAP00000016920 ENSECAP00000016920 9796.ENSECAP00000016920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]