SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000016956 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000016956
Domain Number 1 Region: 346-497
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-33
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000817
Family SAM (sterile alpha motif) domain 0.000055
Further Details:      
 
Domain Number 3 Region: 214-284
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000765
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000016956   Gene: ENSECAG00000019108   Transcript: ENSECAT00000020645
Sequence length 715
Comment pep:known_by_projection chromosome:EquCab2:2:29290868:29300494:-1 gene:ENSECAG00000019108 transcript:ENSECAT00000020645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVATWTPGKVAAWLRGLDDSLQDYCFEDWELPGKYLLQLCPRSLEALTVWPLGHQELI
LEGVEQLRALSSGLQTENLQSLTEGLLEGTHAFRSLVQGHLGGCAEPPADVLSAAVDLVH
EARTLLFWLNRYLFSHLNDFSACQEIGQLCGELGQALQEDCAAAEKESKVLRICSHVAGI
CHNILSYSPKELLEQRAVLERVQLDNPLDLEIHTTTNCLHFVSQVGTQVPTDSQLQILPG
DEIVQINEQVVVGWPHKNVVRELLQKSAGVTLVLKKVPVPETPPQTSPQALGSPQLRISS
LALAPLSPRTPSEDVFAFNLTSDPSPGPSPAWTGNSSSLDSEPLLIPPASPATLLAGVAE
TPKPSEDPDESPVPGRKKSKGVATRLSRRRVSCRELGQPDCDGWLLLRKVPGGFMGPRWR
RCWFVLKGHKLYWYRQPQDEKAEGLINVSNYSLESGQDQKKKYVFQLTHDVYKPFIFAAD
TLADLSMWVRHLITCISKYQSPGRAPLPQEEDCYSETEAEDPDDEAGSRSASPSLAHTCS
PLHGDTSPAATPTRGSPRTSFGSLTDSSEGALEGMVRGLRQGGVSLLGRLQPLTHEQWRS
SFMRRNRDPQLNERVHRVRALQSTLKAKLQELQALEEVLGDPELTGEKFRQWKEQNQELY
SEGLEAWGVVQAEGSSPVLTSDSREQSSHPLPSDPEEHSHLCPLTPESNLQPPDL
Download sequence
Identical sequences F6UHP3
ENSECAP00000016956 ENSECAP00000016956 9796.ENSECAP00000016956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]