SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017292 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017292
Domain Number 1 Region: 65-128
Classification Level Classification E-value
Superfamily BPTI-like 1.7e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 
Domain Number 2 Region: 31-71
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000249
Family Elafin-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017292   Gene: ENSECAG00000019824   Transcript: ENSECAT00000021020
Sequence length 134
Comment pep:novel chromosome:EquCab2:22:34585354:34591087:-1 gene:ENSECAG00000019824 transcript:ENSECAT00000021020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESSRLLRILVLSILLVNVQGSNLSGWLFPRRCPKIQERCEYQERDECTTDEECPDKTKC
CVFSCGKKCLDLLQDVCKMPKETGPCLGLFQRWWYDKKYDTCSTFIYGGCQGNNNNFQSK
AVCQNICSRKGESQ
Download sequence
Identical sequences F7CC15
9796.ENSECAP00000017292 ENSECAP00000017292 ENSECAP00000017292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]