SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017337 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017337
Domain Number 1 Region: 134-276
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 31-136
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-33
Family Second domain of FERM 0.0000885
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017337
Domain Number - Region: 1-29
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000434
Family First domain of FERM 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017337   Gene: ENSECAG00000019696   Transcript: ENSECAT00000021071
Sequence length 442
Comment pep:known_by_projection chromosome:EquCab2:1:145157363:145195056:1 gene:ENSECAG00000019696 transcript:ENSECAT00000021071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HWLEFTKSVVKQLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDLYHGRLLCK
TSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKTELSGQTPA
TSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFIKWNEVTKL
KFEGKTFYLYVSQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQVRTVSSSN
LFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSRSCPSITHGPRLSSVPRTRR
RAVHISIMEGLESLRDSAHSTPVRSSSHGDTFLPHVRSSRADSNERVAVIADEAYSPADS
VLPTPVAEHSLELMLLSRQINGATCSIEEEKESEASTPTAAEVEALGGELRALCQGHSRP
EEEQSGHLKGPPLQQAAAAGVG
Download sequence
Identical sequences F7E2B0
ENSECAP00000017337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]