SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017360 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017360
Domain Number 1 Region: 8-161
Classification Level Classification E-value
Superfamily PR-1-like 4.06e-52
Family PR-1-like 0.00000438
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017360
Domain Number - Region: 160-175
Classification Level Classification E-value
Superfamily Crisp domain-like 0.0146
Family Crisp domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017360   Gene: ENSECAG00000019920   Transcript: ENSECAT00000021096
Sequence length 175
Comment pep:novel chromosome:EquCab2:20:47664031:47669416:-1 gene:ENSECAG00000019920 transcript:ENSECAT00000021096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSTRHLSIQMEIVNTHNDMRRMVKPTASNMLKMMWNHEAAKNAEKWAKKCTLTHSSSSK
RKISFAGCGENILMSSRIKSWPDVIQYFYEELKYFKYGFGRTRANVKIGHYTQLVWPTSH
QLGCALAYCPHKTLKYFYVCQYCPGGNYVKRMNTPYKKGEPCGDCPHHCDNGLCS
Download sequence
Identical sequences F7E1J5
9796.ENSECAP00000017360 ENSECAP00000017360 ENSECAP00000017360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]