SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017824 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017824
Domain Number 1 Region: 1193-1530
Classification Level Classification E-value
Superfamily NHL repeat 6.28e-24
Family NHL repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 1374-1392,1425-1530,1572-1740
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000377
Family DPP6 N-terminal domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 631-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017824
Domain Number - Region: 889-958
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000184
Family Carboxypeptidase regulatory domain 0.035
Further Details:      
 
Domain Number - Region: 600-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000479
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 697-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000479
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 729-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000639
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 565-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0016
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 762-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 535-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0367
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 1540-1681,1722-1741,1852-2028
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0369
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 
Domain Number - Region: 665-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0599
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017824   Gene: ENSECAG00000019099   Transcript: ENSECAT00000021632
Sequence length 2732
Comment pep:known_by_projection chromosome:EquCab2:X:98794524:99311829:-1 gene:ENSECAG00000019099 transcript:ENSECAT00000021632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHDYNQELRMNYNSQ
SRKRKEVEESTQEMEFCETPHTLCSGYQTDMHNVSRHGYQLEMGSDVDTETEGAASPDHA
LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDM
QSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQD
SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
SRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGELYENG
VSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF
QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKASDDTQ
HSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
ECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRNGWKGPECDVPEEQCIDPT
CFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSSHGICVKGECHCSTGWGGVNCETPLP
ICQEQCSGHGTFLLDAGMCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGPT
CEERSCHSHCAEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQN
GWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYVSPLCQGSPDP
LDLIQQSQPLFSQHTSRLFYDRIKFLIGKDSTHVIPPEISFDSRRACVIRGQVVAVDGTP
LVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFLSEKRTLWLPWNQFIV
VEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIP
SSFVRLSYLSSRTPGYKTLLRILLTHSTIPMGMIKVHLTVAVEGRLTQKWFPAAVNLVYT
FAWNKTDIYGQKVWGLAEALVSVGYEYEMCPDFILWEKRTVILQGFEMDASNLGGWSLNK
HHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPVAL
ASGPDGSVYVGDFNFVRRIFPSGNSVSILELRNRDTRHSTSPAHKYYLAMDPVSESLYLS
DTNTRKVYKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITV
DRHGFIYFVDGTMIRRIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVN
PMDNSLYVLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISV
SHSGLLFIAETDERKVNRIQQVTTNGEISIMAGAPTDCDCKIDPNCDCFSGDGGYAKDAK
MKAPSSLAVSPDGTLYVADLGNVRIRTISRNQAQLNDMNLYEIASPADQELYQFTVNGTH
LHTLNLITRDYVYNFTYNAEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTIS
SNGVLKRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSS
FHSDLEKLTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVSPDGSLRVTFASG
MEISLSSEPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNKGNISAFERRLRAHN
RNLLSIDFDHITRTGKIYDDHRKFTLRILYDQTGRPVLWSPVSRYNEVNITYSPSGLVTF
IQRGTWNEKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQSDCLLS
VTMPSMVRHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYT
KQARLSEILYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEG
LVNARFDYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITT
TVMKHTKIFSANGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVDANITRYFYEY
DADGQLQTVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMD
EDGFLRQRGNDIFEYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSLGQHLQFFYAD
LANPIRVTHLYNHSSSEITSLYYDLQGHLIAMELSSGEEYYVACDNMGTPLAVFSSRGQV
IKEILYTPYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIW
KQLNLLPKPFNLYSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPGFPKPELENL
ELTYELLQLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYNDGRCLEGGKQP
RFAAVPSVFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIDGRDTH
YFIKLGSLEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNI
RYGTTVEEEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGY
DGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences F7CJC6
ENSECAP00000017824 9796.ENSECAP00000017824 ENSECAP00000017824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]