SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000017833 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000017833
Domain Number 1 Region: 1193-1524
Classification Level Classification E-value
Superfamily NHL repeat 8.11e-24
Family NHL repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 1423-1469,1496-1660
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000163
Family SGL-like 0.04
Further Details:      
 
Domain Number 3 Region: 631-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000017833
Domain Number - Region: 889-958
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000184
Family Carboxypeptidase regulatory domain 0.035
Further Details:      
 
Domain Number - Region: 697-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000479
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 600-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000479
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 729-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000639
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 565-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0016
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 762-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 535-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0367
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 665-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0599
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000017833   Gene: ENSECAG00000019099   Transcript: ENSECAT00000021641
Sequence length 2725
Comment pep:known_by_projection chromosome:EquCab2:X:98794524:99311829:-1 gene:ENSECAG00000019099 transcript:ENSECAT00000021641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHDYNQELRMNYNSQ
SRKRKEVEESTQEMEFCETPHTLCSGYQTDMHNVSRHGYQLEMGSDVDTETEGAASPDHA
LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDM
QSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQD
SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
SRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPVEGELYENG
VSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF
QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKASDDTQ
HSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
ECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRNGWKGPECDVPEEQCIDPT
CFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSSHGICVKGECHCSTGWGGVNCETPLP
ICQEQCSGHGTFLLDAGMCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGPT
CEERSCHSHCAEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQN
GWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYVSPLCQGSPDP
LDLIQQSQPLFSQHTSRLFYDRIKFLIGKDSTHVIPPEISFDSRRACVIRGQVVAVDGTP
LVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVILIFDRSPFLSEKRTLWLPWNQFIV
VEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIP
SSFVRLSYLSSRTPGYKTLLRILLTHSTIPMGMIKVHLTVAVEGRLTQKWFPAAVNLVYT
FAWNKTDIYGQKVWGLAEALVSVGYEYEMCPDFILWEKRTVILQGFEMDASNLGGWSLNK
HHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPVAL
ASGPDGSVYVGDFNFVRRIFPSGNSVSILELSTSPAHKYYLAMDPVSESLYLSDTNTRKV
YKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITVDRHGFIY
FVDGTMIRRIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVNPMDNSLY
VLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISVSHSGLLF
IAETDERKVNRIQQVTTNGEISIMAGAPTDCDCKIDPNCDCFSGDGGYAKDAKMKAPSSL
AVSPDGTLYVADLGNVRIRTISRNQAQLNDMNLYEIASPADQELYQFTVNGTHLHTLNLI
TRDYVYNFTYNAEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKR
VSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEK
LTKVELDTSNRENVLMSTNLTATSTIYILKQENTQSTYRVSPDGSLRVTFASGMEISLSS
EPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNKGNISAFERRLRAHNRNLLSID
FDHITRTGKIYDDHRKFTLRILYDQTGRPVLWSPVSRYNEVNITYSPSGLVTFIQRGTWN
EKMEYDQSGKIISRTWADGKIWSYTYLEKSVMLLLHSQRRYIFEYDQSDCLLSVTMPSMV
RHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYTKQARLSE
ILYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEGLVNARFD
YSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITTTVMKHTK
IFSANGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVDANITRYFYEYDADGQLQ
TVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMDEDGFLRQ
RGNDIFEYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSLGQHLQFFYADLANPIRV
THLYNHSSSEITSLYYDLQGHLIAMELSSGEEYYVACDNMGTPLAVFSSRGQVIKEILYT
PYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIWKQLNLLP
KPFNLYSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPGFPKPELENLELTYELL
QLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYNDGRCLEGGKQPRFAAVPS
VFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIDGRDTHYFIKLGS
LEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNIRYGTTVE
EEKNHVLEIARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLS
VEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences F7CES3
ENSECAP00000017833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]