SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018004 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018004
Domain Number 1 Region: 90-274
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-62
Family SPRY domain 0.000000681
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000848
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018004   Gene: ENSECAG00000020541   Transcript: ENSECAT00000021829
Sequence length 290
Comment pep:novel chromosome:EquCab2:10:24946657:24949082:1 gene:ENSECAG00000020541 transcript:ENSECAT00000021829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAMGEHFKEASRCCGCMTYLEKPMYLKCGYVCCLQCINSLRKEPNGEGLLCPFCSLVSQK
KDIRPNSQLGVLVSKIKELEPQLRSALQMNPRMWKFQVDMTLDVNTANKHLIISEDLRSV
RCGYFKHCWRTRADRFIYAICVLGSPRFTSGRHYWEVDVGTSKEWDVGICRDSVNRREAF
VLSSDHGFWTVGSRNGDVFSASTVPLTTLLVSPRLHRVGIFLDMDIGIISFYHVSDGSHI
FTFSKISAAEPLRPFFAPANPMKDDQGVLRICPMINAGTAIPPMSPGQGK
Download sequence
Identical sequences F6WDW9
ENSECAP00000018004 ENSECAP00000018004 9796.ENSECAP00000018004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]