SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018163 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018163
Domain Number 1 Region: 378-670
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.27e-84
Family Pancreatic carboxypeptidases 0.000000000635
Further Details:      
 
Domain Number 2 Region: 796-1084
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.52e-68
Family Pancreatic carboxypeptidases 0.0000127
Further Details:      
 
Domain Number 3 Region: 11-261
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.48e-59
Family Pancreatic carboxypeptidases 0.00000161
Further Details:      
 
Domain Number 4 Region: 262-340
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 8.44e-16
Family Carboxypeptidase regulatory domain 0.00062
Further Details:      
 
Domain Number 5 Region: 1085-1178
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000549
Family Carboxypeptidase regulatory domain 0.0093
Further Details:      
 
Domain Number 6 Region: 706-747
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000051
Family Carboxypeptidase regulatory domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018163   Gene: ENSECAG00000020432   Transcript: ENSECAT00000022002
Sequence length 1250
Comment pep:known_by_projection chromosome:EquCab2:11:44011183:44071378:1 gene:ENSECAG00000020432 transcript:ENSECAT00000022002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDAAGPLLPVRPQVKLVGNMHGDETVSRQVLVYLRELAAGYRGDPRLVRLLNTTDVYVLP
SLNPDGFERAREGDCGLGDGGPPGASGRDNSRRDLNRSFPDQFSTGEPPALDDVPEVRAL
IDWIRRNKFVLSGNLHGGSVVASYPFDDSPEHEATGVYSKTSDDEVFKYLAKAYASNHPI
MKTGTPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQ
LRQEWENNRESLITLIEKVHIGVKGFVKDLVTGSGLENATISVAGINHNITTGRFGDFHR
LLLPGTYNITAALTGYMPLTVNNIIVKEGPAAKVNFSLRPTVTSVISDTTDVVTASTVAI
LNIPPGTQSSHQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVME
ISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVQSTRIHL
MPSMNPDGYEKAQEGDSVSVIGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMKAY
PFVLSANLHGGSLVVNYPFDDDEQGVATYSKSPDDAVFQQIALSYSKENSQMFQGRPCKN
MYPNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPFEKDLPKFWEQNR
RSLIQFMKQVTIQEKSYILKLSDVLKFKQLCLKFNHPVTTYKTDYWRLLPGTYKITASAR
GYNPVTKNVTVKGEGAIQVNFTLVRSSADSNNESKKGKGDSTNTEDASDPTTKVFETLIK
DLSAENGLEALILRSSSNLALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGQSAEYRHIW
SLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKRNPALTQLVDRTR
IVIVPSLNPDGRERAQEKDCTSKIGRTNARGKDLDTDFTNNASQPETKAIIENLIQRQDF
SLSVALDGGSVLVTYPYDKPVQTVENKETLKHLASLYASNHPSMHLGQPGCPNKSDENIP
GGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSATQLPSLWAENRKSLLSMLV
EVHKGVHGFVKDKTGKPISKAVIVLNEGIKVHTKEGGYFHVLLAPGVHNINAIADGYQQQ
HSQVFVHHDAASSVVIVFDTDNRIFGLRELVVTVSGATMSALILTAGIIWCICSIKSNRH
KDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences F6UFH2
ENSECAP00000018163 9796.ENSECAP00000018163 ENSECAP00000018163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]