SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018300 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018300
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 398-503
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-23
Family Third domain of FERM 0.0063
Further Details:      
 
Domain Number 3 Region: 40-138
Classification Level Classification E-value
Superfamily PDZ domain-like 2.4e-17
Family PDZ domain 0.017
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000011
Family Ras-binding domain, RBD 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018300   Gene: ENSECAG00000020791   Transcript: ENSECAT00000022163
Sequence length 1574
Comment pep:known_by_projection chromosome:EquCab2:25:2685353:2823908:1 gene:ENSECAG00000020791 transcript:ENSECAT00000022163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELETSLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADGPPGIPAQTLTTVKHTVKI
EKDAVLQDYGFHISESLPLTVVAVTAGGSAHGKLFPGDQILQINDKFAEDLSYERAADIL
REAGDSLSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLVSGHSQGNSLLCMP
NVLKLYLENGQTKAFKFEANTTVKDIIVTVKEKLSIRSTEYFALALEEQYNISRLHLLHE
EELIQQVVEREETHDYRCLFRMCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGKIFNATLMLQDRESYIALLVGA
KYGISQIINSKLNIMSTLAEFANISRVELTEESEKVSMVKVYLQDVKVLTLLLESNSAKD
LACLIAGYYRLFVDPVTSIFLWPGNKHQGHRVSAEEGYESRACSDSEESSEVDCMPEPRS
DGRLPKPGPCRPLVQEQQPPGDSPAPEVARRGPSTCGASSTTDSAESEASDSANTESRGC
RTSGSSESVDALEEDDLDACSSSRSGFFPFSSPGFLESLDSDSQEERNRIETSGFLCLLD
LAQRANAQGQKTEFPESPAPETFSWGPELSAVPLDPRLYEGSQTDYYSLCSSVSPASHLS
DSSENTASRQGGGPPAWGQQGWTEPQPSSTLEALAPHLPLAFEDGSSDEEYYDAADKLTP
PDALSGPRAVSAADPSATSLQNTARTCSLEDSLNPGLDGRQPSRRGGVKKYAKTLRKRRS
FLQTDYTCQVSFPLVPSASLESVDHVCYYDREPYLALGAPSLTVSSLQDVQAEPGLLETK
ALGLLASLGETKNKNPASRVMEMEPETMETKSVIDSRVSSISAVRLRIDPNHRENSAAVA
GSPASTPRCSNPGLSGPDTAQAGPSQTLPPFQDSEGSAREELAIELGDSTSSLCSADLNP
DRVCLTVSPGPHSVSPGDTLELGGVQLEMGLGSLFTNHMQEPAPKSTEPLLSPQDRPRSG
ECGTNSGEMMASFPTKEEQRGQLSLEDDGEVRNENGTNLFHDESGKDSGDAEGDAFNAIP
QTVGVSDPASGAIASFSMETPVTGTEQTPAHSPMDRQAQSREPLGQACQTQEQRLLLAEL
DLDPDFLLRNQIIPLACPLEGVKAEPLNHVTGEDAAHRDTSQQVSFNPGPLLPKPPPCPQ
EEPHLESSNHGSLSESKDKSPSICFPAENAFLCLAPESHPKISANLRTATSLGFAGVNET
AAPRFGMEQCSCQFSYATCFRGLQPETQEDDRDLEAHLTAPLTSPPSAGSRLAQPWRRTR
AHSCSAEPLSRNNHTWPEYCSKALRQLKAAPTSTPEGFIQLTESLLELQDILDAAWGNAN
KHPPEKCTWHFSESRSRLCMGSQKLLSSCQHVIRMDQSAEEMQGAVRDTFQHLVQLAGLC
FQFTDCSRCSARHREAAGNLRDVVDTYHQFVEAAKLTCERGYQDLSVKLLARQCTALTAA
VFCLTQKFRASTAL
Download sequence
Identical sequences F6VJG5
ENSECAP00000018300 XP_001504324.1.31192 ENSECAP00000018300 9796.ENSECAP00000018300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]