SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018367 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018367
Domain Number 1 Region: 4-82
Classification Level Classification E-value
Superfamily PDZ domain-like 6.1e-17
Family PDZ domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018367
Domain Number - Region: 195-295
Classification Level Classification E-value
Superfamily PH domain-like 0.00615
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018367   Gene: ENSECAG00000020715   Transcript: ENSECAT00000022243
Sequence length 403
Comment pep:known_by_projection chromosome:EquCab2:22:24371176:24392307:-1 gene:ENSECAG00000020715 transcript:ENSECAT00000022243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVV
LEVKYMKEVSPYFKNSASGTSVGWDSPPASPLQRQPSSPGLQPQDLSNAKHVSLKMAYVS
RRCTPTDPEPSNLPKITQPGSDGICLIPGSPLCFRSCRCLSDGVLGVVYKWHKHKRHQTI
LEVSGLEDSIGLKQIGWLTEQLPSGGTAPTLALLTEKELLLYGCLPKTREALSRPARTAP
LIATRLVHSGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHR
AAEGVQEVSTACTWNGRPCTLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGAS
LLFLDFGGAEGEIQLDLHSCPKTMVFIIHSFLSAKVTRLGLLA
Download sequence
Identical sequences F6V2J7
ENSECAP00000018367 ENSECAP00000018367 9796.ENSECAP00000018367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]