SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018475 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018475
Domain Number 1 Region: 4-753
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.69e-275
Family Motor proteins 0.000000000281
Further Details:      
 
Domain Number 2 Region: 1914-2030
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-22
Family Second domain of FERM 0.004
Further Details:      
 
Domain Number 3 Region: 2031-2120
Classification Level Classification E-value
Superfamily PH domain-like 4.25e-19
Family Third domain of FERM 0.019
Further Details:      
 
Domain Number 4 Region: 1213-1315
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000381
Family Ubiquitin-related 0.042
Further Details:      
 
Domain Number 5 Region: 1814-1922
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000107
Family Ras-binding domain, RBD 0.053
Further Details:      
 
Domain Number 6 Region: 1307-1401
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000118
Family Second domain of FERM 0.0057
Further Details:      
 
Domain Number 7 Region: 1529-1596
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000616
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 8 Region: 758-822
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000131
Family Motor proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018475   Gene: ENSECAG00000020054   Transcript: ENSECAT00000022361
Sequence length 2139
Comment pep:known_by_projection chromosome:EquCab2:18:3154614:3219940:-1 gene:ENSECAG00000020054 transcript:ENSECAT00000022361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHWIRAEDFGTLSPMHPNSVQGVEDMIRLGDLNEAGIVHNLLIRYQQHKIYVSPPGETYT
GSILVAVNPFQVLPLYTLEQVQLYYNRHMGELPPHVFAIANNCYFNMKRNKRDQCCVISG
ESGAGKTETTKLILQFLATISGQHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYID
IYFNPSGVIEGARIEQFLLEKSRVCRQAPEERNYHIFYCMLLGMSTEEKQLLGLGTPSEY
RYLTMGNCTSCEGLNDAKDYAHIRSAMKILMFSDSENWDLSKLLAAILHLGNVEFMAAVF
ENLDSSDVMETPAFPTAMKLLEVKHEALRDCLIKHSIIVRGEFVTMPLNLAQAADRRDAF
VKGIYGHLFLWIVKKINAAIFTPPAQDPKNVRRAIGLLDIFGFENFENNSFEQLCINFAN
EHLQQLFVQHVFTMEQEEYRSEGIAWDYIHYTDNRPTLDLLALKPMSIISLLDEESHFPQ
GTDITMLQKLNSVHANNKAFLQPRNIYDARFGIAHFAGKVYYQAEGFLEKNRDVLSTDIL
ALVHSSENKFLREIFNLEAPGAHSSKRPPTLAGQFKRSLDQLMKILTNCQPYFIRCIKPN
EYKKPLLFDRELCLRQLRYSGMMETVHIRKSGFPIRYAFDEFARRFRVLLPSAERTQLRD
KFRQMTLRIAEMWLGTDKDWKVGKNKIFLKESHDVLLEVQRSQALDKAAVSIQRVLRGYK
YRKEFLRQRRAAVTIQAGWRGYCNRRNFKLILLGFERLQAIARSHQLAKQYQATRQRTVQ
LQALCRGYLVRQQVQAKKRAVVVIQAHARGMAARRDFQRQKANVGQRNTKRRLQVSAQER
LKGRAQGDRARARASKRADPQTRQQQASPAGPLAIPAEEQKSRSALPTRKRKSIYDTITD
TEMVEQVFGFLPSMIGGQESQASPRFEDLEARSQQLPEVDLDTVPMVEEPEEDLDDLAEY
TFPKFAVTYFQKSASHTHLRRPLRYPLLYHEDSADCSAALAVWCIILRFMGDLPEPVLFA
RNSLRGGSSVMQQIHDTLGRGNSTPDQQMLRAGGEALRTPPHVKDKGIKGISSMKLKRSS
RITGQVASQLNIGEEAFEPDGPISERPMSNLEKVHFIVGCAILRPSLRDEIYCQICKQLS
ENFKTSSVARGWILLSLCLGCFPPSERFMKYLLNFIGHGPASYGPFCAERLRRTYANGVR
TEPPTWLELQAVKSKKRIPIHVILVTGERLTVMVDSASTSREVCLHIAHKQGLNDHLGFS
LQVTVYDKFWSLGSGRDHVMDAIAQCEQLAWERGEKERQAPWRIYFRKEFFTPWHDSRED
PVSTQLIYRQVLLGILSGEYSFEKEEELVELLARHCYVQLGASPGSEAVQELLPGCVPSK
LYRTKSPEKWASLVTAAHTKAQYTQKRATPLAVQEQVVDAARLQWPLLFSQLFEVTPLSG
PRLPKTQLILAVNWKGLYFLDQREKMLLELSFPEIMSLITNSGPRQAAVSVLLLSTLHKE
EYEFLSPSSVAIAELVALFLEGLKERSVFAMALQDRKATGGCDVTLLPFKKGDLLILTKK
QGLLASENWILGQNDRTGKTGLVPMAYLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQ
PPELSPDEQPKEPHTLEEFSYEFFRAPEKETISRAVFPMGRTRGHLWAHSVEPLRQPLLK
RVHASAELCDVASAAPILRYMGDYPSRQAWTSLELSDQIFSLALQDPALQDEVYCQILKQ
LTHNTKRYSEERGWQLLWLCTGLFPPGKALLPHAQKFIDTRRKKLLAPDCSRRLQRVLRT
GPRKQPPHQVEVEAMEQNVSRICHKIYFPNDTSEMLEVGSNTRVRDVCNSISTTLQLASW
EGCSLFIKIADKVISQKEGDFFFDSLRHVSDWVKRNKPHREGAAVTLPYQVYFMRKLWLH
VVPGKDVNADTILHYHQELPKYLRGFHKCSREDAIHLAGLIYKAQFGNDRAHLASIPKIL
RELVPENLTRLMSSEEWRKSILLACEQHRDKTVEEAKVAFLKWICRWPTFGSAFFEVKQT
SEPSYPDIILIAINRHGVLLIHPKTKELLTTYPFTKIASWSSGSTYFHMVLGTLGRGSRL
LCETSLGYKMDDLLTSYVQQLLSTVNKQRGSQAPALAEL
Download sequence
Identical sequences F6TIS0
ENSECAP00000018475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]