SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018481 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018481
Domain Number 1 Region: 73-192
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.14e-61
Family RUNT domain 0.000000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018481   Gene: ENSECAG00000020875   Transcript: ENSECAT00000022367
Sequence length 462
Comment pep:known_by_projection chromosome:EquCab2:20:44102875:44220604:1 gene:ENSECAG00000020875 transcript:ENSECAT00000022367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIPVDPSTSRRFSPPSSSLQPGKMSDVSPVQQQQQQQQQQQQQQQQEAAAGKRRRRRRR
QAVFRSCPDHRLTTGELVRTDSPNFCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVM
AGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAI
KVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPF
NPQGQSQITDPRQAQSPPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPR
RISGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYH
TYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNG
STLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
Download sequence
Identical sequences F6TIE9
9796.ENSECAP00000018481 ENSECAP00000018481 ENSECAP00000018481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]