SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018611 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018611
Domain Number 1 Region: 1240-1401
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-75
Family Pleckstrin-homology domain (PH domain) 0.0000000425
Further Details:      
 
Domain Number 2 Region: 1036-1243
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-52
Family DBL homology domain (DH-domain) 0.00000000679
Further Details:      
 
Domain Number 3 Region: 459-581
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 844-915
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000319
Family PDZ domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000018611
Domain Number - Region: 770-809
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0393
Family Ras-binding domain, RBD 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018611   Gene: ENSECAG00000020848   Transcript: ENSECAT00000022515
Sequence length 1591
Comment pep:known_by_projection chromosome:EquCab2:26:28128152:28307186:-1 gene:ENSECAG00000020848 transcript:ENSECAT00000022515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNVEHEFYGEKHASLGRKHTSRSLRLSHKARRTRHASSGKVMHRNSEVSTRSSS
TPSIPQSLAESGLEPFSQEGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDSEESRLYGDDATYLAEGGGRQRPYTSNGPAFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRASPRRLSSCQRANSLSDLYAQKN
SGVTANGGPRSKFAGYCRNLVSDIPDLANHKMPPAAAGEALPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFVDSGIEGATTDTDLLSRRSNATNSSYSPP
AGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
DAVKKSLEGIFDDTVPDGKREKEMVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIGNKIQHYVPKPEEDIYELLYKEIEICP
KVTQNIQIEKSDTAGDNYGFSLSSVEEDGVRRLYVNSVKETGLASKKGLKAGDEILEINN
RAAGTLNSSVLKDFLTQPSLGLLVRTYPELEGGAELLESPPHRADGPADLSESPLAFLTS
NPGHGPCSEQGGSAEVAPEETEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDPSSS
PQDSAGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDSAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
KELFALTDAESEEHYHLDVAVKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWPNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEDWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAISASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCEAVKGAAVDRDLQERLQAASISQRERGRKTLDSHASRMTQLKKQAALS
GINGGLESTSEEVIWVRREDFAPSRKLNTEI
Download sequence
Identical sequences F6URL2
ENSECAP00000018611 XP_001498883.1.31192 XP_005606181.1.31192 ENSECAP00000018611 9796.ENSECAP00000018611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]