SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018649 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018649
Domain Number 1 Region: 250-438
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 1.7e-65
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.00000746
Further Details:      
 
Domain Number 2 Region: 9-102
Classification Level Classification E-value
Superfamily A heparin-binding domain 2.22e-34
Family A heparin-binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 103-168
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 4.97e-28
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018649   Gene: ENSECAG00000021024   Transcript: ENSECAT00000022559
Sequence length 604
Comment pep:known_by_projection chromosome:EquCab2:10:7051089:7058978:1 gene:ENSECAG00000021024 transcript:ENSECAT00000022559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSPQAPGSAQVAGLCGRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQI
ARVEQATQAIPMERWCGGARGGRCAHPHHQVVPFHCLPGEFVSEALLVPEGCRFLHQERM
DQCESSTRRHQEAQEACSSQGLILHGSGMLLPCGTDRFRGVEYVCCPPPVTPNPSGTAVG
DPSTRSWPPGSRVEGVEDEEEEESFLQPVDDYFVEPPRAEEEEEEKAPPSSSHTPAGVSK
VTPTPRPTDGVDVYFGMPGEISEHEGFLRAKMDLEERRMRQINETAFDPGFHPSSSLLTL
CPPRCQHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQGDLPQP
ERVLLALRRYLRAEQKEQRHTLRHYQHVAAVDPEKAQQMRFQVQTHLQVIEERMNQSLGL
LDQNPQLAQELRPQIQELLHSEHLGPNELEAPAPAGSSEDKGELQPLDSKDDTPMALPKG
STEQDAASPGKENMSPLEQYERKVNVSVPRGFPFHSSEIQRDELAPAGTGVSREAVSGLL
IMGAGGGSLIVLSLLLLRRKKPYGAISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFL
EERP
Download sequence
Identical sequences F6UCG9
ENSECAP00000018649 ENSECAP00000018649 9796.ENSECAP00000018649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]