SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018651 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018651
Domain Number 1 Region: 118-309
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.69e-73
Family T-box 0.00000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018651   Gene: ENSECAG00000021052   Transcript: ENSECAT00000022561
Sequence length 555
Comment pep:known_by_projection chromosome:EquCab2:16:55824824:55829752:1 gene:ENSECAG00000021052 transcript:ENSECAT00000022561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AATARYSMDSLSSERYYLQSPGPQGSELAAPCSLFPYQAAAGAAHGSVYPAPNGARYPYG
SMLPPGGFPAAVCPPGRAHSGPGAYQYSQGAPLYGPYPGAAAAGLGGLGVPGSGFRAHVY
LCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNINGLNPSAHYNVFVEVVLADPNHWRFQ
GGKWVTCGKADNNMQGNKMYVHPESPNTGSHWMRQEISFGKLKLTNNKGANNNNSQMIVL
QSLHKYQPRLHIVEVTEDGVEDLNEPSKTQTFTFSETQFIAVTAYQNTDITQLKIDHNPF
AKGFRDNYDSMYTASENDRLTPSPTDSPRSHQIVPGGRYGVQSFFPEPFVNTLPQARYYN
GERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDIGSYESEYTSSTLLPYGIK
SLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPPVFSEDQLSKEKVK
EEISSSWIETPPSIKSLDSNDSGVYTSACKRRRLSPNTSSNENSPSIKCEDINTEEYSKD
TSKGMGGYYAFYTTP
Download sequence
Identical sequences F6UBY0
ENSECAP00000018651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]