SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018653 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018653
Domain Number 1 Region: 2-285
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.94e-56
Family BAR domain 0.000000441
Further Details:      
 
Domain Number 2 Region: 261-356
Classification Level Classification E-value
Superfamily PH domain-like 1.38e-23
Family Pleckstrin-homology domain (PH domain) 0.0000132
Further Details:      
 
Domain Number 3 Region: 455-594
Classification Level Classification E-value
Superfamily PH domain-like 5.07e-21
Family Phosphotyrosine-binding domain (PTB) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018653   Gene: ENSECAG00000020564   Transcript: ENSECAT00000022563
Sequence length 645
Comment pep:known_by_projection chromosome:EquCab2:28:28427504:28473878:-1 gene:ENSECAG00000020564 transcript:ENSECAT00000022563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTRSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSKQLLAYEKQNFALGK
GDEEVISTLHYFSKVVDELNVLHTELAKQLADTMVLPIIQFREKDLTEVSTLKDLFGLAS
NEHDLSMAKYSKLPKKKENEKVKTEVVKEVAAARRKQHLSSLQYYCALNALQYRKRVAMM
EPMIGFAHGQINFFKRGAEMFNQSMDSFLSSVADMVQSIQVEQEAEAEKMRVSQQELLSV
DESVYTPDFDVSTPQINRNLIQKAGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQPRGAV
AGGLIQDLDNCSVMAVDCEDRRYCFQITTPNGKSGIILQAESRKENEEWICAINNISRQI
YLTDNPEAVAIKLNQTALQAVTPITSYGKKQESSRPSQNLKNSEMENDKIVPKTTVNVPE
PEQLIAPGTPIQFDIVLPATEFLDQNRGGRRVNPFGETEDDTFPEAEDSLLQQMFIVRFL
GSMAVNTDSTAEVIYEAMRQVLAARAIHNIFRMTETHLMVTSQTLRLIDPQTQVTRANFE
LTSVTQFAAHQENKRLVGFVVRMPESTGGESLSTYIFESNSEGEKICYAINLGKEIIEVQ
KDPEALARLMLSIPLTNDGKYVLLNHPPDDTDGSPSENRGAESEA
Download sequence
Identical sequences F6UBU6
9796.ENSECAP00000018653 ENSECAP00000018653 ENSECAP00000018653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]