SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018693 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018693
Domain Number 1 Region: 246-437
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 2.35e-67
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.00000594
Further Details:      
 
Domain Number 2 Region: 5-98
Classification Level Classification E-value
Superfamily A heparin-binding domain 2.22e-34
Family A heparin-binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 99-164
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 4.97e-28
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018693   Gene: ENSECAG00000021024   Transcript: ENSECAT00000022609
Sequence length 603
Comment pep:known_by_projection chromosome:EquCab2:10:7051101:7058978:1 gene:ENSECAG00000021024 transcript:ENSECAT00000022609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAPGSAQVAGLCGRLTLHRDLRTGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARVE
QATQAIPMERWCGGARGGRCAHPHHQVVPFHCLPGEFVSEALLVPEGCRFLHQERMDQCE
SSTRRHQEAQEACSSQGLILHGSGMLLPCGTDRFRGVEYVCCPPPVTPNPSGTAVGDPST
RSWPPGSRVEGVEDEEEEESFLQPVDDYFVEPPRAEEEEEEKAPPSSSHTPAGVSKVTPT
PRPTDGVDVYFGMPGEISEHEGFLRAKMDLEERRMRQINEPHPFRSVSCDSPTSRPTAPP
PPLGPHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQGDLPQPE
RVLLALRRYLRAEQKEQRHTLRHYQHVAAVDPEKAQQMRFQVQTHLQVIEERMNQSLGLL
DQNPQLAQELRPQIQELLHSEHLGPNELEAPAPAGSSEDKGELQPLDSKDDTPMALPKGS
TEQDAASPGKENMSPLEQYERKVNVSVPRGFPFHSSEIQRDELAPAGTGVSREAVSGLLI
MGAGGGSLIVLSLLLLRRKKPYGAISHGVVEVDPMLTLEEQQLRELQRHGYENPTYRFLE
ERP
Download sequence
Identical sequences F6U3Z2
ENSECAP00000018693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]