SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018719 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000018719
Domain Number 1 Region: 236-564
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.93e-76
Family Pancreatic carboxypeptidases 0.00000214
Further Details:      
 
Domain Number 2 Region: 56-218
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00044
Further Details:      
 
Domain Number 3 Region: 565-662
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.9e-17
Family Carboxypeptidase regulatory domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018719   Gene: ENSECAG00000021019   Transcript: ENSECAT00000022640
Sequence length 675
Comment pep:known_by_projection chromosome:EquCab2:22:19960299:19965044:1 gene:ENSECAG00000021019 transcript:ENSECAT00000022640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTSEQHVRIRIIKKKKIIMKKRKKLTRPTPPVTAGPPVTTNPAKALDLPEKQEPGCPPLG
LESLRVTDSQLEASSSQSFGLGPHRGRLNIQSGLEDGDLYDGAWCAEEQDSEPWFQVDAR
HPTRFSGVITQGRNSIWRYDWVTSYKVQFSNDSRTWWGSRNRSSGMDAVFPANSDPETPV
LNLLPEPQVARFIRLLPQTWLQGGASCLRAEILACPVSDPNSLFPEAPVLGSPDPLDFRH
HNYKAMRKLMKEVNEQCPNITRVYSIGKSHQGLKLYVMEMSDQPGEHELGEPEVRYVAGM
HGNEALGRELLLLLMQFLCREFLRGDPRVTRLLTEMRIHLLPSMNPDGYETAFRRGSELV
GWAEGRWNQQGIDLNHNFADLNTPLWEAEDDGLVPDTVPNHHLPLPTYYTLPNATVAPET
RAVIQWMERIPFVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDDAVFRWLSTVYAGT
NRAMQDPDRRPCHNQDFSLHGNVINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPH
ENELPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGD
YWRLLTPGDYMVTASAEGYHTVTRSCRVTFEEGPMPCNFHLTKTPKQRLRELLAAGAKVP
PDLRRRLERLRGQKD
Download sequence
Identical sequences F6TFH2
ENSECAP00000018719 ENSECAP00000018719 9796.ENSECAP00000018719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]