SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000018817 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000018817
Domain Number - Region: 187-212,253-308
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000127
Family Matrix metalloproteases, catalytic domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000018817   Gene: ENSECAG00000021322   Transcript: ENSECAT00000022754
Sequence length 502
Comment pep:known_by_projection chromosome:EquCab2:13:4528304:4539385:-1 gene:ENSECAG00000021322 transcript:ENSECAT00000022754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQCRPAQEFSFGPRALKDALVSTDPALQRLYASAFSPAERLFLAEAYNPQRTLFRTLRI
RTAFDWLLSRPEAPEDFQTFHGSLPPRKQSPARKHIYLQPIDLSEGPAGGVLLDHLRSCT
EAFFPGLQVRCLPAVAAASIRCSSRPSQDSERLQLHTDGILSFLKNSKPGDALCVLGLTL
SDLYPCEAWSFTFGKFLPGHEVGVCSFARFSGEFLQVGPSAPDPAPAEVAAEGPETPLQD
RGQTLCFSALGMVQCCKVACHELCRLLGLGHCRWLRCLMQGVLSLDEALRRPLDLCPICL
RKLQHVLGFKLVERYKRLYSWTQAVVGTPPGPEAGEPSLSEDTLPGSADSGLCCESDSEP
GTSLSEPLSPDTWSRAFSAGPELEPEDGLSSLAASEGLPQLGMPAEAIREHGRWLATCIQ
ALEREVTEEELARVDGAVDALARWEMFTGRLPATRQDLPCGGDGPGLRKVLGDKFSSLRR
KLSARKPSKADASPCRWKAEEH
Download sequence
Identical sequences F6QZ01
ENSECAP00000018817 9796.ENSECAP00000018817 XP_001492430.3.31192 XP_008515967.1.77740 ENSECAP00000018817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]