SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019100 from Equus caballus 76_2

(show help)
Strong hits

Sequence:	ENSECAP00000019100
Domain Number 1	Region: 72-135
Classification Level	Classification	E-value
Superfamily	BPTI-like	1.42e-17
Family	Small Kunitz-type inhibitors & BPTI-like toxins	0.0043
Further Details:

Domain Number 2	Region: 31-79
Classification Level	Classification	E-value
Superfamily	Elafin-like	0.0000000000419
Family	Elafin-like	0.0021
Further Details:

Domain Number 3	Region: 138-183
Classification Level	Classification	E-value
Superfamily	Elafin-like	0.00000000589
Family	Elafin-like	0.0015
Further Details:

Domain Number 4	Region: 180-228
Classification Level	Classification	E-value
Superfamily	Elafin-like	0.00000209
Family	Elafin-like	0.0018
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSECAP00000019100 Gene: ENSECAG00000021682 Transcript: ENSECAT00000023076
Sequence length	230
Comment	pep:known_by_projection chromosome:EquCab2:22:34595938:34604123:-1 gene:ENSECAG00000021682 transcript:ENSECAT00000023076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	PLHSSTFSWRNVALLVLLFLSLEQTSASLSKKVKHKPGECPKERLTCTSKLPDSCKTDFN CHEHLKCCSFACGKKCMDPYQEPCSLPLDPGNCESPARHWYFDFKDHLCKPFAYRGCDGN ANNFFNREDCKTACSLAAKKGQCPLFPLKNRMMCSALCKSDIDCPQTEKCCESICGFVCA TAWTVKAGFCPRKPTECSKIDKPKCLRDDDCPVSEKCCSRCGLKCMEPQN
Download sequence
Identical sequences	F6WMJ9 9796.ENSECAP00000019100 ENSECAP00000019100 ENSECAP00000019100

SEARCH