SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019376 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019376
Domain Number 1 Region: 325-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.00000000000000127
Family DNA-binding domain from NDT80 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019376   Gene: ENSECAG00000021799   Transcript: ENSECAT00000023397
Sequence length 1109
Comment pep:known_by_projection chromosome:EquCab2:12:21688792:21708026:1 gene:ENSECAG00000021799 transcript:ENSECAT00000023397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAGHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASAASYPHGQPAIPSSSGVH
HLSPPGGGPSPGRHGPLPPPSYSAPLNCNNNNGMGAAPKPFLGGSGPPIKAEPKAPYAPG
TLPDSPPDSGSEAYSPQQVNDPHLLRTITPETLCHVGVPSRLEHPPPPPAHLPGPPPPPP
PPPHYPILQRDLYMKAEPPMPPYAAMGQGLVPTDLHHTQQSQMLHQLLQQHGAELPTHPS
KKRKHSESPPNTLNAQMLNGMIKQEPGTVTALPPHPTRAPSPPWPPQGPLSPGPGSLPLS
IARVQTPPWHPPGAPSPGLLQDNDSLSGSYLDPNYQSIKWQPHQQNKWATLYDANYKELP
MLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKYVKTPEGLKPLDCFYLKL
HGGVDLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANNMRKK
GKPNPDQRYFMLVVALQAHAQNQNYTLAAQISERIIVRASNPGQFESDSDVLWQRAQGPA
PFFHQSTFGGNTGPVSESLFAHVQAPARCGFIVPLSPRSLHQGTQVDTMEQLKRISRMRL
VHYRYKPEFAASAGIEATAAPETGVIAQEVKEILPEAVKDTGDVVFANGKTIENFLVVNK
ERIFMENVGAVKELCKLTDNLETRIDELERWSHKLAKLRRLDSLKSTGSSGAFSHAGSQF
SRAGSVPHKKRPPKVASKSSSVVPDQACISQRFLQGTIIALVVVMAFSVVSMSTLYVLSL
RTEEDLVETDGRSSQSFGTTQLRQSPVTTGLPGTQPSLLLVTAGLVSSAPGPAIRTVDLC
FSRPCPVVCCSSSTPSPTPAPSLGPSSNPSHGLSPSPSPSTNRSGPSQMALLPVTNIRAK
SWGLSANGIGHFKHSKSLEPVASPAVPFPGGQGKAKNSPSLGLHGRARRGAPQPGLSPVQ
PTQARDQPDPVPSLTSIQVLENSMPITSLYCAPGNACRPGNFTYHIPISSSTPLHLSLTL
QMNSSSPVSVVLCRLMSKEEPCEEGGFLQSLHTHQDTQGTSHQWPVTILSFREFTYHFRV
ALLGQANCSAEALARPATDYYFHFYRLCD
Download sequence
Identical sequences F6WRH5
ENSECAP00000019376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]