SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019391 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019391
Domain Number 1 Region: 323-526
Classification Level Classification E-value
Superfamily p53-like transcription factors 0.00000000000000132
Family DNA-binding domain from NDT80 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019391   Gene: ENSECAG00000021799   Transcript: ENSECAT00000023414
Sequence length 1139
Comment pep:known_by_projection chromosome:EquCab2:12:21688798:21708026:1 gene:ENSECAG00000021799 transcript:ENSECAT00000023414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHDINGALEPSNIDTSILEEYISKEDASDLCFPDISAPASAASYPHGQPAIPSSSGVHHL
SPPGGGPSPGRHGPLPPPSYSAPLNCNNNNGMGAAPKPFLGGSGPPIKAEPKAPYAPGTL
PDSPPDSGSEAYSPQQVNDPHLLRTITPETLCHVGVPSRLEHPPPPPAHLPGPPPPPPPP
PHYPILQRDLYMKAEPPMPPYAAMGQGLVPTDLHHTQQSQMLHQLLQQHGAELPTHPSKK
RKHSESPPNTLNAQMLNGMIKQEPGTVTALPPHPTRAPSPPWPPQGPLSPGPGSLPLSIA
RVQTPPWHPPGAPSPGLLQDNDSLSGSYLDPNYQSIKWQPHQQNKWATLYDANYKELPML
TYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKYVKTPEGLKPLDCFYLKLHG
GVDLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANNMRKKGK
PNPDQRYFMLVVALQAHAQNQNYTLAAQISERIIVRASNPGQFESDSDVLWQRAQGPAPF
FHQSTFGGNTGPVSESLFAHVQAPARCGFIVPLSPRSLHQGTQVDTMEQLKRISRMRLVH
YRYKPEFAASAGIEATAAPETGVIAQEVKEILPEAVKDTGDVVFANGKTIENFLVVNKER
IFMENVGAVKELCKLTDNLETRIDELERWSHKLAKLRRLDSLKSTGSSGAFSHAGSQFSR
AGSVPHKKRPPKVASKSSSVVPDQACISQRFLQGTIIALVVVMAFSVVSMSTLYVLSLRT
EEDLVETDGSFAVSTSCLLALLRPQHPGGSEALCPWSSQSFGTTQLRQSPVTTGLPGTQP
SLLLVTAGLVSSAPGPAIRTVDLCFSRPCPVVCCSSSTPSPTPAPSLGPSSNPSHGLSPS
PSPSTNRSGPSQMALLPVTNIRAKSWGLSANGIGHFKHSKSLEPVASPAVPFPGGQGKAK
NSPSLGLHGRARRGAPQPGLSPVQPTQARDQPAKSLQPDPVPSLTSIQVLENSMPITSLY
CAPGNACRPGNFTYHIPISSSTPLHLSLTLQMNSSSPVSVVLCRLMSKEEPCEEGGFLQS
LHTHQDTQGTSHQWPVTILSFREFTYHFRVALLGQANCSAEALARPATDYYFHFYRLCD
Download sequence
Identical sequences F6WKH5
ENSECAP00000019391 ENSECAP00000019391 9796.ENSECAP00000019391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]