SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019444 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019444
Domain Number 1 Region: 77-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000117
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 2 Region: 163-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000107
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019444
Domain Number - Region: 128-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000196
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019444   Gene: ENSECAG00000022046   Transcript: ENSECAT00000023474
Sequence length 206
Comment pep:known_by_projection chromosome:EquCab2:2:5458043:5466806:1 gene:ENSECAG00000022046 transcript:ENSECAT00000023474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRISPQGEGNGNSAAGTKARPGGEADCSPLCCSRRRACVSAILLLLLATLAALIALVAI
CGPPPRTPGAQACVTPKNRTGFLCHDRRSCIPAHGVCDGIRTCAHGEDEDEALCRDVPQS
LPRFLVAHCGHPASWIYSDQKCDGTNNCGDCSDELSPGGVCPPCGPGWWRCPSTVFRFCG
CIPRSLCRDHVQHCSDWSDEYSCPGP
Download sequence
Identical sequences F6YG16
XP_001492890.3.31192 XP_008538108.1.77740 ENSECAP00000019444 9796.ENSECAP00000019444 ENSECAP00000019444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]