SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019519 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019519
Domain Number 1 Region: 356-546
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 8.89e-83
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.0000000055
Further Details:      
 
Domain Number 2 Region: 10-104
Classification Level Classification E-value
Superfamily A heparin-binding domain 7.59e-45
Family A heparin-binding domain 0.0000015
Further Details:      
 
Domain Number 3 Region: 105-169
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 2.48e-29
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.00001
Further Details:      
 
Domain Number 4 Region: 267-325
Classification Level Classification E-value
Superfamily BPTI-like 6.67e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019519   Gene: ENSECAG00000021011   Transcript: ENSECAT00000023558
Sequence length 751
Comment pep:known_by_projection chromosome:EquCab2:26:23516785:23711628:-1 gene:ENSECAG00000021011 transcript:ENSECAT00000023558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPTDGNAGLLAEPQIAMFCGKLNMHMNVQNGKWESDPSGTKTCIGTKEGILQYCQEVYPE
LQITNVVEANQPVTIQNWCKRGRKQCKTHAHIVIPYRCLVGEFVSDALLVPDKCKFLHQE
RMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSA
DAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEDVADVEEEEAEDDEDDEDGDEVEEEAE
EPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPF
FYGGCGGNRNNFDTEEYCMAVCGSVMSQSLLKTPQEPLPQDPVKLPTTAASTPDAVDKYL
ETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKV
ESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVR
AEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQ
DEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQ
PWHPFGVDSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDS
GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVD
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Download sequence
Identical sequences F6XL78
9796.ENSECAP00000019519 ENSECAP00000019519 ENSECAP00000019519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]