SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019640 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019640
Domain Number 1 Region: 1-687
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.33e-190
Family Motor proteins 0.0000000302
Further Details:      
 
Domain Number 2 Region: 1723-1797
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000443
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 2127-2237
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000903
Family Second domain of FERM 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019640
Domain Number - Region: 1898-2026
Classification Level Classification E-value
Superfamily ARM repeat 0.0729
Family MIF4G domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019640   Gene: ENSECAG00000021920   Transcript: ENSECAT00000023695
Sequence length 2328
Comment pep:novel chromosome:EquCab2:11:6394104:6424858:-1 gene:ENSECAG00000021920 transcript:ENSECAT00000023695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFGGPLLLALNPHRPLPLFSPEVLASYRPRKAPNTTPHIFAIVASAYGLSQSTGQGTCIL
LSGQSGSGKTEASKKIVQFLSSLEQEQMRDRGCQLDGVLPLLSSFGHAKTVLNANASRFG
QVLCLCLQQGVVVGASVSHYLLETSRVVFQAQAERSFHVFYELLAGLDPMEREQLSLQGP
ETYYYINQGQACRLQGKEDAQDFTGLVKALQVLGLRPEELTTVWAVLASILQLGNICFSS
SERESQEVAAVSSWAEIHTAARLLRVPPERLEGAVTRRVMETAYGQVWRSLPVESAIDAR
DALAKALYSRLFTWLLRRTNARLAPPGKGGSTDTVTVVDVYGFEALRVNGLEQLCNNLAS
ERLQLFSSQMLLAQEEEECRRELLPWVPIPQPPWESCLDLLADQPHSLLSILDAQTWLSQ
ATDHTFLQKCHYHHGGHPCYAKPQLPLPIFTVRHYAGTVTYQVHKFLNRNRDHLDPAVVE
MLAQSSLQLVGSLFQEAEPPSGGGRGKPTLASRFQHSLGDLMAQLGRSHIYLIQCLNPNP
GKHPGLFDVGHVAEQLRQAGILEAVCARSANFPVRVPFQAFLARFRALGTEGQGEPSDRE
RCGAILSQVLGAKSPLCHLGATQVLLQEPGWQQLQQHWAQRRSQMLLTLHRGLLTCISHQ
RLRLLPRMQARVHGLQARKRYLLRRAALGQLHTILLVARPLLWRRRRLQLGHWCGWHGGR
ASEKVPSMELGRLEIPAELAVMLKTAEGRQHAVAESITESLPPEVPARPSLTLPLDIDQF
PFSSFVSISFQEPSLPSPGQLLAKPLTRLNGENPQHALDINKVMLRLLGDGSLPPWQEQI
MGEYLVRQGQRRPGLRDELFSQLVAQLWHNPDEQQSQRGWALMAILLSAFPPMPTLQKPL
LKFVSDQAPRGMAALCQHKLLGALEQMQLAPESARAHPPTQLEWTAGRRRGRMALDVFTF
NEECYSAEVESWTTGEQLAGWILQSRGLEVPPRGWSVSLHSGDSWQDLAGCDFVLDLIGQ
TEDLGDPAGPHSYPITPRSLAEDIPPAPGVQAPSLPPGPPPGPAPTRPIRSHTGKARTPG
GLDGFLDHLFEPVLSGGNSDLEQGWALRGRMKGGGAMGPMQPGSYPMMYPGMVQMPGYQP
AMMPAPMPMMPAMGVVPPMPAMVVPPQPQPQPLPPSVDARQLAVQQQNFINQQALILAQQ
MTTQAMTLSLEQQTQQRRRQRQAPAQAPVPEAASPPPPPPPAITPKPKKPQVPQEEPERE
PESVDGCLRQETLQEAEDRPQRPKSFQQKRDYFQRMGQQQIKVKTVKPPAKVQIPQGEEQ
EEEEEEERPKAVPSPPPPPPPPQVVKKPLTQGGAKATKEAEAEPTQEVGPGSDRLAQGRA
VVRSSDPAPQRAEPSREIRNIIRMYQSRPGPVPEPVQPSRPPKNFMKKNNPKDEALAKLG
INGAYSSPAMLPPSPGKGPPPAVAPRPKASPRPGSSTTIKEKQAPLREVFGPTPPTAQAP
PPPPAPPLPLPGDLGTPSAEPRGSTVPMGDQGVSTQLLVPSGSVCFSYASTSWKLFLRKE
VFYPRENFSHAYCLRLLCEQILRDTFAKSCIRISQDERRKMKQLLGDLEVGLESLDTTED
SVKKRIVVAARDNWANYFSRIFPVSGESGSDMQLLGVSHRGLRLLKVTQGPSFYPDQLKT
LCSYSFAEVLGVECPDSSTLELSLKSEQLVLHTARASVIKAMAGCFLTRSLACLQDSGYV
IALRSYITDDSSLLSFHRGDLIKLLPVATLEPGWQFGSTGGRSGLFPADIVQPAAAPDFS
FSSEQRNGRHKKSGLWDRAPEHPAFPQSQAHSEDSEATSLPPSMAYLSVFTDSHNYTMQE
FALRYFRKPQALLHQTGGGAEQKAPASLVQYTKAPIQESLINLSDEGMNRQAVESFQALM
QFMGDQSKPRGKGEMELLYELLKLCQEENLRDEIYCQVIKQVTGHPRPEHCARGWSFLSL
LTGFFPPSTTLMPYLTKFLQDSGLSQELARTSQEHLQRTVKYGGRRQLPFPGEMQAFLKG
HTVRLVLIHLPGGVDYKTNIQTFTVAGEVLEELCGQMSIMDPQEVQEFALFLIKGEGELV
RPLRPDEYLNSVMVDKDVSLHSRRLGWETQLHFDNPTYISTHYSQVLRDYLQGKLLVSAQ
AEDLLARLAALQHLSRAFQDTPSEQDLLAYLPKTLQWQVRRATIRMLMGQELRRLKGCTS
QEAQTSFIEAVRQLPLFGYTVYVVLRVSEVALPGPGFLGLNRQHIILMDPSSQKLCCSVA
LRELQRIHLLSPLEEQGSPGLELNYGSADSPRTIWFELPQAQELKHTI
Download sequence
Identical sequences F6YWG9
9796.ENSECAP00000019640 ENSECAP00000019640 ENSECAP00000019640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]