SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019644 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019644
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.34e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 59-116
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019644   Gene: ENSECAG00000022247   Transcript: ENSECAT00000023700
Sequence length 158
Comment pep:novel chromosome:EquCab2:5:30908287:30911282:-1 gene:ENSECAG00000022247 transcript:ENSECAT00000023700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCRMPPIIAHGSRKDVSLFFSFTTVVQYECDEGYVLVGEAKITCKNSRWSSPAPQCKALC
RKPEIENGNLSVDKDQYVEPENVAVQCDSGYVVVGSQSITCSAKGTWYPEVPKCEWEVPR
GCQQALTGSKLMQCLSRPEDVKMALEFYKLSLEIQQME
Download sequence
Identical sequences F6YWC0
ENSECAP00000019644 9796.ENSECAP00000019644 ENSECAP00000019644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]