SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019671 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019671
Domain Number 1 Region: 339-529
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 1.07e-79
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.000000122
Further Details:      
 
Domain Number 2 Region: 12-104
Classification Level Classification E-value
Superfamily A heparin-binding domain 6.93e-42
Family A heparin-binding domain 0.00000551
Further Details:      
 
Domain Number 3 Region: 105-170
Classification Level Classification E-value
Superfamily Amyloid beta a4 protein copper binding domain (domain 2) 4.18e-28
Family Amyloid beta a4 protein copper binding domain (domain 2) 0.0000627
Further Details:      
 
Domain Number 4 Region: 270-329
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019671   Gene: ENSECAG00000021265   Transcript: ENSECAT00000023727
Sequence length 728
Comment pep:known_by_projection chromosome:EquCab2:7:38599732:38634456:1 gene:ENSECAG00000021265 transcript:ENSECAT00000023727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFGTKEEVLQYCQEMY
PELQITNVMEANQPVSVDNWCRRDRKQCRSHIVIPFKCLVGEFVSDVLLVPEKCQFFHKE
RMEVCENHQHWHAVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIESTVSK
EDEEDEEEEEGEDEEEDYDIYKSEFPTEADLEDFTEAAVDVDDEDEEEGEEVVEDRDYYY
DTFKGDDYNEENPTERSSDGTISEKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKC
VRFIYGGCGGNRNNFESEDYCMAVCKTMIPPTPLPTNDVDVYFETSADDNEHARFQKAKE
QLEIRHRNRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASEKQQLVET
HLARVEAMLNDRRRMALENYLAALQSDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVL
AVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQF
TASLSETPVDVRVSSEESDEIPPFRPFHPFPSLPGDEDTQPELYRPMRKGSGVGEQDRAL
IGAEEKVINSKNKVDENMAIDETLDVKEMIFNAERVGGLEEEPESVGPLREDFSLSSSAL
IGLLVIAVAIATVIVISLVVLRKRQYGTISHGIVEVDPMLTPEERHLNKMQNHGYENPTY
KYLEQMQI
Download sequence
Identical sequences F6YPX2
ENSECAP00000019671 ENSECAP00000019671 9796.ENSECAP00000019671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]