SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019719 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019719
Domain Number 1 Region: 47-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000548
Family EGF-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019719
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00371
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019719   Gene: ENSECAG00000022318   Transcript: ENSECAT00000023777
Sequence length 157
Comment pep:novel chromosome:EquCab2:25:27543341:27546337:1 gene:ENSECAG00000022318 transcript:ENSECAT00000023777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPVLPEECSLNSTCIKGGPCEGGPRGANCSCREGFPGQRWCQTVHMPCEANPCLNGGTC
RVAGGLYECICNARFSGRFCEVLKGLPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAA
RKRRQSEGTYSPSQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences F6Z0G7
9796.ENSECAP00000019719 ENSECAP00000019719 ENSECAP00000019719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]