SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019725 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019725
Domain Number 1 Region: 56-235
Classification Level Classification E-value
Superfamily vWA-like 2.64e-39
Family Integrin A (or I) domain 0.00082
Further Details:      
 
Domain Number 2 Region: 1399-1599
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-38
Family Pentraxin (pentaxin) 0.00043
Further Details:      
 
Domain Number 3 Region: 1936-2004
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 2119-2187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-18
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 5 Region: 1820-1889
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 2806-2875
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 3214-3283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.73e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 8 Region: 2748-2817
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 1762-1831
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-17
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 10 Region: 2354-2424
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 11 Region: 2864-2933
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 12 Region: 2690-2759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 13 Region: 1663-1721
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-16
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 14 Region: 3038-3106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 15 Region: 2529-2596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 16 Region: 2238-2306
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 17 Region: 2648-2701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 18 Region: 2413-2482
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.34e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2471-2534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 20 Region: 3391-3450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2923-2985
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000806
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 22 Region: 1878-1941
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000118
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 23 Region: 3273-3339
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 413-479
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000445
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 25 Region: 2982-3047
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000764
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 26 Region: 352-423
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000001
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 27 Region: 1603-1669
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 28 Region: 1993-2061
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 29 Region: 3095-3163
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000556
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 30 Region: 3332-3400
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000598
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 2297-2365
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000723
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 32 Region: 2179-2243
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000764
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 33 Region: 1273-1395
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000014
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 34 Region: 1206-1248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000879
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 35 Region: 1244-1287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000105
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 36 Region: 962-1106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000143
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 37 Region: 3156-3218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000181
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 38 Region: 1170-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000384
Family EGF-type module 0.013
Further Details:      
 
Domain Number 39 Region: 2058-2124
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000667
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 40 Region: 1716-1759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family EGF-type module 0.033
Further Details:      
 
Domain Number 41 Region: 253-407
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000981
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 42 Region: 472-535
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000153
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019725
Domain Number - Region: 3442-3478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000211
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 3481-3510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000246
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 3510-3541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000803
Family EGF-type module 0.028
Further Details:      
 
Domain Number - Region: 703-763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000946
Family Complement control module/SCR domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019725   Gene: ENSECAG00000021653   Transcript: ENSECAT00000023783
Sequence length 3546
Comment pep:known_by_projection chromosome:EquCab2:25:15545761:15711601:-1 gene:ENSECAG00000021653 transcript:ENSECAT00000023783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSRNFSFRLFPEGPGLRGRLPSPPAPGEDAAESKVERLGQAFRRRVRRLRELSERLEL
VFLVDESSSVGQANFLSELKFVRKLLSDFPVVPTATRVAIVTFSSKNNVVPRVDYISSRR
AHQHKCALLSQEIPAITYRGGGTYTKGAFQQAAQILRHSRENSTKVIFLITDGYSNGGDP
RPVAASLRDFGVEIFTFGIWQGNIRELNDMASTPKEEHCYLLHSFEEFEALARRALHEDL
PSGSFIQEDMSHCSYLCEAGKDCCDRMASCKCGTHTGQFECICEKGYYGKGLQYECTACP
SGTYKSEGSPGGISTCLPCPDENHTSRPGSTSPEDCVCKQGYRASGQTCEVVHCPALKPP
ENGYFIQNTCNNHFNAACGVRCHPGFDLVGSSILLCLPNGLWSGSESSCRVRTCPRLRQP
KHGRISCSAGEMSYKTTCLVTCDEGYRLEGSAKLTCQGNAQWDGLEPRCVERHCSTFQKP
KGVIISPPNCGKQPAKPGMVCQLSCRQGFILSGVRDEVRCTTSGKWSARVQTAVCKDVEA
PQISCPKDIEAKTQEQQDSANITWQIPTAKDNSGEKVSIHVHPAFTPPYLFPIGDVAITY
TATDLSSNQASCTFHIKVIDVEPPSIDWCRSPPPIQVSEKEHAVTWDEPQFSDNSGAVLV
ITRSHTPGDLFPHGETVVRYTATDPSGNYRTCDIHIVIKGSPCEVPFTPVNGDFVCTQDS
AGVNCTLSCLEGYDFTEGSTEKYYCAYEDGIWKPPYSTEWPDCAIKRFANHGFKSFEMLY
KATRCDDTDLLKKFSEAFETTLGKMVPSFCSDADDIDCRLEDLTKKYCLEYNYEYENGFA
IGPGGWGTANRLDYSYDDFLDAVRETPTGAGKARSSRSKRNAPLSDHKIKLIFNITASVP
LPEERNDTLELENQQRLIKTLETITNRLKRTLNKEPMYSFQLASEMLVADSNSLETEKAF
LFCRPGSVLRGRMCVNCPLGTSYSLEHSVCESCLMGSYQDEEGQLECKLCPPGTYTEYLH
SRSSSECKAQCKQGTYSSNGLETCESCPLGSYQPAFGSRSCLFCPENTSTVKRGAVDIAA
CGVPCPVGEFSRSGLMPCYPCPQDYYQPNPGKSFCLSCPFYGTTTITGARSITDCSSFSS
TFSAAEESIVPLASTGNIKKKYEVSTNVFHECFLNPCHNSGTCQQLGRGYVCLCPRGYTG
LKCEIDIDECSSLPCLNSGICKDGVGEFVCECPSGYTGQLCEENINECSSSPCLNKGTCI
DGLAGYRCTCVKGYAGLHCETEVNECQSSPCLNNAVCEDQVGGFLCKCPPGFLGTRCEKN
VDECLSQPCRNGATCKDGANSFRCQCAAGFTGPRCELNINECQSNPCRNQATCVDELNSY
SCKCRPGFSGSRCETEQSTGFNLDFEVSGIYGYVMLDGVLPSLRAVTCTFWMKSSDTTNY
GTPISYALEKGSDNTFLLTDYNGWVLYVNGKEKITDCPAVNDGSWHHIAITWTSADGAWK
VYIDGKLSDGGVGLSVGSAIPGGGALVLGQEQDKKGEGFNPAESFVGSISQLNLWDYVLS
PQQVKSLATSCPEELNKGNVLAWPDFLSGIVGKVKIDSKSIFCSDCPPLEGSVPHLRTAS
ANLKPGSKISLFCDPGFQMVGNPVQYCLNQGQWTQPLPHCERISCGVPPPLENGFYSAED
FHAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCSEHASCLNTN
GSYVCSCIPPYTGDGKNCAEPVKCKPPGNPENGHSSGEIYTVGAEVTFSCEEGHQLMGET
KITCLESGEWSHLMPYCEAVSCGAPAFPENGGIDGSTFTYGSKVVYRCDKGYTLDGDKES
SCLASGSWSHSPPVCELVKCSSPENINNGKYILSGLTYLSTASYSCESGYSLQGPSVIEC
SASGSWDRAPPTCHLVFCGEPPAIKDAVITGSNFTFGNTVTYTCKEGYTLAGPDTIECLA
SGKWSGSNQQCLAVSCDEPPNVEHASPETAHRLFGDIAFYYCSDGYSLADNSQLICNAQG
KWVPPEGQAVPRCIAHFCEKPPSVSYSILESVSKAKFAAGSVVSFKCMEGFVLNTSAKIE
CMRGGQWNPSPLSIQCIPVRCGEPPSIMNGYASGSNYSFGAMVAYSCNKGFYVKGEKKST
CEATGQWSSPTPTCHPVSCNEPPKVENAFLEHATGRIFESEVRYQCNPGYKSVGSPVFVC
QANRHWHSESPLSCIPLNCGKPPPIQNGYMKGENFEVGSKVQFFCNEGYELVGDNSWTCQ
KSGKWNKKPNQKCVPTKCPEPPLLENQLVLKELTTEVGVVMFSCKEGHALQGPSVLKCLP
SQQWNDSFPICKMVLCLPPPLISFGVPAPSSALHFGSTVKYSCVDGFFLRGDPTTFCQAD
GTWSSPLPECVPVECPQPEEILNGIIDVQGLAYLSTALYTCKPGFELVGNTTTLCGENGH
WLGGKPTCKPIECPKPKKILNGKFTYTNLHYGQTITYSCDRGFRLEGPKALTCLETGNWD
VDVPSCNAIHCNPPQPIENGFVEGADYSYGAMIIYSCIPGFQVAGHAMQTCEESGWSSSI
PTCVPIDCGLPPHIDFGDCTKVKDGQGYFDQEEDVMEVPYVTPHPPRHLGAVAKTWKNTK
GSPATHSANFLYGTMVSYTCNPGYELLGNPVLICQEDGTWNGSAPSCISIECDLPVAPEN
GFLHFTETTMGSAAQYSCKPGHILVGSDIRLCLQNREWSGTSPRCEAISCKKPNPVMNGS
IKGSNYTYLSVLYYECNPGYVLNGTERRTCQGNKNWDGDEPICIPVDCGSPPISANGQVK
GDEYTFQKEIEYTCKVGFLLEGARSRVCLANGTWSGTTPICVPVRCASPPQVANGAMDGL
DYGLGKEVVFHCQEGYVLYGAPKLTCQSDGTWDAEVPLCKPVNCGPPEDLAHGFPNGFSF
SHGGQIQYQCFSGYKLHGSPSRKCLSNGSWSGSPPSCLPCRCSTPVIQNGAVNGTDFGCG
TAAQIQCFKGFKLLGLSEITCEANGQWSSGFPRCEHASCGSLPVIPNAFITESGSLEENV
ITYNCRPGYVIQGSSDLICMEKGMWSQPHPVCEPVSCGPPPSVANAVATGEAHTYESKVK
LRCLEGYMMDTDIDTFTCQKDGLWFPETISCSPRKCPLPANITHLLIHGDDFSVNKQVSV
SCAEGYTNEGVNTSTCQPDGTWEPPFSDESCSPVSCGEPESPEHGFVVGSEYTFESTVIY
QCEPGYELEGNGERTCQENSQWSGGVATCKKSKCESPLGFLNGKAEIENTTAGPSVVYSC
SRGYSLEGAPEAYCTENGTWSQPVPLCKPNPCPVPFVIPENALLSEKEFYVDQNVSIKCR
EGFLLQGQGVITCNPDETWTQTSAKCEKISCGPPTHVENAIARGVHYQYGDMITYSCYSG
YMLEGSLRSVCLENGTWTSPPICRAVCRFPCQNGGVCQRPNACSCPDGWMGRLCEEPICI
LPCLNGGRCVAPYQCDCPPGWTGSRCHTAVCQSPCLNGGKCVRPNRCHCLSSWTGHDCSR
KRRTGF
Download sequence
Identical sequences F6Z058
ENSECAP00000019725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]