SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019748 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019748
Domain Number 1 Region: 78-258
Classification Level Classification E-value
Superfamily vWA-like 2.5e-39
Family Integrin A (or I) domain 0.00082
Further Details:      
 
Domain Number 2 Region: 1422-1622
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.33e-38
Family Pentraxin (pentaxin) 0.00043
Further Details:      
 
Domain Number 3 Region: 1959-2027
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 2142-2210
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-18
Family Complement control module/SCR domain 0.00079
Further Details:      
 
Domain Number 5 Region: 1843-1912
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 2829-2898
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 3237-3306
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 8 Region: 2771-2840
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 9 Region: 1785-1854
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-17
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 10 Region: 2377-2447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 11 Region: 2887-2956
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.61e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 12 Region: 2713-2782
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.03e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 13 Region: 1686-1744
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.36e-16
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 14 Region: 3061-3129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 15 Region: 2552-2619
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 16 Region: 2261-2329
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 17 Region: 2671-2724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 18 Region: 2436-2505
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.34e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 2494-2557
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 20 Region: 3414-3473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2946-3008
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000806
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 22 Region: 1901-1964
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000012
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 23 Region: 3296-3362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 436-502
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 25 Region: 3005-3070
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000764
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 26 Region: 375-446
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000001
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 27 Region: 1626-1692
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 28 Region: 2016-2084
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 29 Region: 3118-3186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000556
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 30 Region: 3355-3423
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 31 Region: 2320-2388
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000723
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 32 Region: 2202-2266
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000778
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 33 Region: 1381-1421
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000026
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 34 Region: 1343-1385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000042
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 35 Region: 1267-1310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000544
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 36 Region: 1229-1271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000879
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 37 Region: 3179-3241
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000181
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 38 Region: 1193-1234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000022
Family EGF-type module 0.013
Further Details:      
 
Domain Number 39 Region: 994-1142
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 40 Region: 2081-2147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000681
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 41 Region: 1305-1347
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 42 Region: 1739-1782
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family EGF-type module 0.033
Further Details:      
 
Domain Number 43 Region: 495-558
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000153
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000019748
Domain Number - Region: 276-416,462-479
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000126
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 3465-3501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000185
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 3504-3533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000231
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 726-786
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00096
Family Complement control module/SCR domain 0.0067
Further Details:      
 
Domain Number - Region: 3533-3563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00104
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019748   Gene: ENSECAG00000021653   Transcript: ENSECAT00000023810
Sequence length 3569
Comment pep:known_by_projection chromosome:EquCab2:25:15550484:15711670:-1 gene:ENSECAG00000021653 transcript:ENSECAT00000023810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPRLAFCCWGLALVSGWATFQQMSPSRNFSFRLFPEGPGLRGRLPSPPAPGEDAAESKV
ERLGQAFRRRVRRLRELSERLELVFLVDESSSVGQANFLSELKFVRKLLSDFPVVPTATR
VAIVTFSSKNNVVPRVDYISSRRAHQHKCALLSQEIPAITYRGGGTYTKGAFQQAAQILR
HSRENSTKVIFLITDGYSNGGDPRPVAASLRDFGVEIFTFGIWQGNIRELNDMASTPKEE
HCYLLHSFEEFEALARRALHEDLPSGSFIQEDMSHCSYLCEAGKDCCDRMASCKCGTHTG
QFECICEKGYYGKGLQYECTACPSGTYKSEGSPGGISTCLPCPDENHTSRPGSTSPEDCV
CKQGYRASGQTCEVVHCPALKPPENGYFIQNTCNNHFNAACGVRCHPGFDLVGSSILLCL
PNGLWSGSESSCRVRTCPRLRQPKHGRISCSAGEMSYKTTCLVTCDEGYRLEGSAKLTCQ
GNAQWDGLEPRCVERHCSTFQKPKGVIISPPNCGKQPAKPGMVCQLSCRQGFILSGVRDE
VRCTTSGKWSARVQTAVCKDVEAPQISCPKDIEAKTQEQQDSANITWQIPTAKDNSGEKV
SIHVHPAFTPPYLFPIGDVAITYTATDLSSNQASCTFHIKVIDVEPPSIDWCRSPPPIQV
SEKEHAVTWDEPQFSDNSGAVLVITRSHTPGDLFPHGETVVRYTATDPSGNYRTCDIHIV
IKGSPCEVPFTPVNGDFVCTQDSAGVNCTLSCLEGYDFTEGSTEKYYCAYEDGIWKPPYS
TEWPDCAIKRFANHGFKSFEMLYKATRCDDTDLLKKFSEAFETTLGKMVPSFCSDADDID
CRLEDLTKKYCLEYNYEYENGFAIGPGGWGTANRLDYSYDDFLDAVRETPTGAGKARSSR
SKRNAPLSDHKIKLIFNITASVPLPEERNDTLELENQQRLIKTLETITNRLKRTLNKEPM
YSFQLASEMLVADSNSLETEKAFLFCRPGSVLRGRMCVNCPLGTSYSLEHSVCESCLMGS
YQDEEGQLECKLCPPGTYTEYLHSRSSSECKAQCKQGTYSSNGLETCESCPLGSYQPAFG
SRSCLFCPENTSTVKRGAVDIAACGVPCPVGEFSRSGLMPCYPCPQDYYQPNPGKSFCLS
CPFYGTTTITGARSITDCSSFSSTFSAAEESIVPLASTGNIKKKYEVSTNVFHECFLNPC
HNSGTCQQLGRGYVCLCPRGYTGLKCEIDIDECSSLPCLNSGICKDGVGEFVCECPSGYT
GQLCEENINECSSSPCLNKGTCIDGLAGYRCTCVKGYAGLHCETEVNECQSSPCLNNAVC
EDQVGGFLCKCPPGFLGTRCEKNVDECLSQPCRNGATCKDGANSFRCQCAAGFTGPRCEL
NINECQSNPCRNQATCVDELNSYSCKCRPGFSGSRCETEQSTGFNLDFEVSGIYGYVMLD
GVLPSLRAVTCTFWMKSSDTTNYGTPISYALEKGSDNTFLLTDYNGWVLYVNGKEKITDC
PAVNDGSWHHIAITWTSADGAWKVYIDGKLSDGGVGLSVGSAIPGGGALVLGQEQDKKGE
GFNPAESFVGSISQLNLWDYVLSPQQVKSLATSCPEELNKGNVLAWPDFLSGIVGKVKID
SKSIFCSDCPPLEGSVPHLRTASANLKPGSKISLFCDPGFQMVGNPVQYCLNQGQWTQPL
PHCERISCGVPPPLENGFYSAEDFHAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGISPS
CLDVDECAVGSDCSEHASCLNTNGSYVCSCIPPYTGDGKNCAEPVKCKPPGNPENGHSSG
EIYTVGAEVTFSCEEGHQLMGETKITCLESGEWSHLMPYCEAVSCGAPAFPENGGIDGST
FTYGSKVVYRCDKGYTLDGDKESSCLASGSWSHSPPVCELVKCSSPENINNGKYILSGLT
YLSTASYSCESGYSLQGPSVIECSASGSWDRAPPTCHLVFCGEPPAIKDAVITGSNFTFG
NTVTYTCKEGYTLAGPDTIECLASGKWSGSNQQCLAVSCDEPPNVEHASPETAHRLFGDI
AFYYCSDGYSLADNSQLICNAQGKWVPPEGQAVPRCIAHFCEKPPSVSYSILESVSKAKF
AAGSVVSFKCMEGFVLNTSAKIECMRGGQWNPSPLSIQCIPVRCGEPPSIMNGYASGSNY
SFGAMVAYSCNKGFYVKGEKKSTCEATGQWSSPTPTCHPVSCNEPPKVENAFLEHATGRI
FESEVRYQCNPGYKSVGSPVFVCQANRHWHSESPLSCIPLNCGKPPPIQNGYMKGENFEV
GSKVQFFCNEGYELVGDNSWTCQKSGKWNKKPNQKCVPTKCPEPPLLENQLVLKELTTEV
GVVMFSCKEGHALQGPSVLKCLPSQQWNDSFPICKMVLCLPPPLISFGVPAPSSALHFGS
TVKYSCVDGFFLRGDPTTFCQADGTWSSPLPECVPVECPQPEEILNGIIDVQGLAYLSTA
LYTCKPGFELVGNTTTLCGENGHWLGGKPTCKPIECPKPKKILNGKFTYTNLHYGQTITY
SCDRGFRLEGPKALTCLETGNWDVDVPSCNAIHCNPPQPIENGFVEGADYSYGAMIIYSC
IPGFQVAGHAMQTCEESGWSSSIPTCVPIDCGLPPHIDFGDCTKVKDGQGYFDQEEDVME
VPYVTPHPPRHLGAVAKTWKNTKGSPATHSANFLYGTMVSYTCNPGYELLGNPVLICQED
GTWNGSAPSCISIECDLPVAPENGFLHFTETTMGSAAQYSCKPGHILVGSDIRLCLQNRE
WSGTSPRCEAISCKKPNPVMNGSIKGSNYTYLSVLYYECNPGYVLNGTERRTCQGNKNWD
GDEPICIPVDCGSPPISANGQVKGDEYTFQKEIEYTCKVGFLLEGARSRVCLANGTWSGT
TPICVPVRCASPPQVANGAMDGLDYGLGKEVVFHCQEGYVLYGAPKLTCQSDGTWDAEVP
LCKPVNCGPPEDLAHGFPNGFSFSHGGQIQYQCFSGYKLHGSPSRKCLSNGSWSGSPPSC
LPCRCSTPVIQNGAVNGTDFGCGTAAQIQCFKGFKLLGLSEITCEANGQWSSGFPRCEHA
SCGSLPVIPNAFITESGSLEENVITYNCRPGYVIQGSSDLICMEKGMWSQPHPVCEPVSC
GPPPSVANAVATGEAHTYESKVKLRCLEGYMMDTDIDTFTCQKDGLWFPETISCSPRKCP
LPANITHLLIHGDDFSVNKQVSVSCAEGYTNEGVNTSTCQPDGTWEPPFSDESCSPVSCG
EPESPEHGFVVGSEYTFESTVIYQCEPGYELEGNGERTCQENSQWSGGVATCKKSKCESP
LGFLNGKAEIENTTAGPSVVYSCSRGYSLEGAPEAYCTENGTWSQPVPLCKPNPCPVPFV
IPENALLSEKEFYVDQNVSIKCREGFLLQGQGVITCNPDETWTQTSAKCEKISCGPPTHV
ENAIARGVHYQYGDMITYSCYSGYMLEGSLRSVCLENGTWTSPPICRAVCRFPCQNGGVC
QRPNACSCPDGWMGRLCEEPICILPCLNGGRCVAPYQCDCPPGWTGSRCHTAVCQSPCLN
GGKCVRPNRCHCLSSWTGHDCSRKKKKGL
Download sequence
Identical sequences F6YUK8
9796.ENSECAP00000019748 ENSECAP00000019748 ENSECAP00000019748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]