SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019791 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000019791
Domain Number - Region: 47-130
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0248
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019791   Gene: ENSECAG00000022382   Transcript: ENSECAT00000023858
Sequence length 291
Comment pep:novel chromosome:EquCab2:5:17191398:17192523:-1 gene:ENSECAG00000022382 transcript:ENSECAT00000023858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRRNMFQIREEDKSSEKELNETEINHLPDREYKLTVIRMLTDLGSRIDEHSKNFNQEL
ENIKKNQSKLKNWGQPSGAEMKNLLQGINGRVDDTAEQISELDERVEEITQAEQQKEKRS
KKKKDSLKDLWDNIKHTNICINGVPEGKERDKGAENLFEEIIAETFPTKGNRYVYKAQRA
PNKRKPKRATPRHIIIKMLRIKDRILKAARQRQQVTYKGNADFSAETSQARREWHDIFQV
LKGKNLQPRIFYPARLSFRIEREIESFPDKPKLKEFITNKPGLQEMLKGLI
Download sequence
Identical sequences F7A776
9796.ENSECAP00000019791 ENSECAP00000019791 ENSECAP00000019791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]