SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019821 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019821
Domain Number 1 Region: 88-270
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.06e-74
Family T-box 0.000000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019821   Gene: ENSECAG00000022374   Transcript: ENSECAT00000023889
Sequence length 432
Comment pep:known_by_projection chromosome:EquCab2:13:19631810:19636109:-1 gene:ENSECAG00000022374 transcript:ENSECAT00000023889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHPRELYPSLGTGYRLGPPQPGADSNFPPALAEGYHYPDLDTPKLDCFLSGIEAAPRTL
AAPPPLPPALGTEPAPPAPEALHSLPGVSLSLENRELWKEFNSVGTEMIITKAGRRMFPA
CRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGA
HWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRVHLVRAAQLCSQHWGGVASFRFPE
TMFISVTAYQNPRITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPVATEAYGS
GDAPGGPCDSTLGGDIRESDPEQAPAPGEAAPASAPPCGGPSAEAYLLHPAAFHGAPGHR
AGLNPSFPEAPDSGHPAPYSAAFLELQPGPGASGYPGAPPAPFASHFLQGGPFPLPYPGP
GAYLDVGSKPMY
Download sequence
Identical sequences F6ZBV5
9796.ENSECAP00000019821 ENSECAP00000019821 ENSECAP00000019821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]