SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019871 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019871
Domain Number 1 Region: 185-381
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.28e-51
Family Reprolysin-like 0.00037
Further Details:      
 
Domain Number 2 Region: 402-478
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.02e-16
Family Blood coagulation inhibitor (disintegrin) 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019871   Gene: ENSECAG00000022220   Transcript: ENSECAT00000023947
Sequence length 730
Comment pep:novel chromosome:EquCab2:27:5308739:5399909:1 gene:ENSECAG00000022220 transcript:ENSECAT00000023947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLFLILSGLGRLTTAVHDSETPLIQITVPWKIGTNSSDDAVSGNHVAYAIKIDGKIYT
FHLKKQSFLDPHFLVYSYNKSGTLYPDSSFIKSHCFYQGYAAEVPKSVVTLSTCSGLRGL
LKLENVSYGIEPLGSAATYEHMLHRIKNNKISFPPLQETYPMTELVDKSFRIFVKSEKNS
DALTKRILKMQIVMDKALYNYMGSEVAVATEKVVHIFSLINTMFSQLKMTVMLTSLEIWS
DQNKISSNGDADEVLQRFVSWKEKFLFQRSHDMAFLLIYRDHQNYVGATYHGMACDPKFA
AGIALYPKTITLDAFSIVMVQLLGINLGLTYDDIYNCYCPGTTCIMNPQAIRSHGVKFFS
SCSVNEFKHVVSQPQFECLQNQTVSKVVYQEKSSTCGNQVLEQFEECDCGSVEECSHKKC
CHPENCTLIGNAECGSGICCDKKTCEIIGRGTICRESKDPCDFTEYCNGISEFCVPDTKA
FDLEPCNNKTAFCYGGTCRDPDVQCLELFGKFARGSTYLCTQEVNFQSDDYGNCNRGRCN
YKQIHCGKMVCHWTHSQIVPSTTYDIQYTFLGHVCMSAFIRNRSVSVANDRTYAVDGTIC
DEQKYCSRGACLFVSDYPGKNRCISETKCQGHGICNNFLNCQCDAGYAPPTCEPTSSSPG
GSVDDGFWTVEREENNTYSFIKRRAAAPRKNGLLISFYVFLPFLILTAVIALKWNKIKRS
WKREETVSEG
Download sequence
Identical sequences F7BQB4
ENSECAP00000019871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]