SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000019912 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000019912
Domain Number 1 Region: 64-248
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.97e-52
Family T-box 0.00000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000019912   Gene: ENSECAG00000022406   Transcript: ENSECAT00000023995
Sequence length 375
Comment pep:known_by_projection chromosome:EquCab2:12:27325392:27329215:-1 gene:ENSECAG00000022406 transcript:ENSECAT00000023995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAFLSAGLGVLAASETYPLPMTSSSWEHRLDSPFPSGPSTSSTEAPAVAEPTGQGPKNPR
VSSVTVQLEMKALWEEFNQLGTEMIVTKAGRRMFPTFQVKILGMDTLADYALLMDFVPLD
DKRYRYAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLLDNN
GHGTLRSDLRIQKTLHAVSQRVTNARRKRNPGRGLFWDSGFYSVRGGSPRRITQLKIASN
PFAKGFRESDPDSWTLSPRPLLGVPARSCSSLSSCPTEQGKDPNKAPASTSRTPARLHHQ
LLAPPEALLTPATYRPITYQGLYPGASSSLRNPRARPTPYPLPNLQANRDQGGLALPAGL
RLLSSTTMCLGPGQD
Download sequence
Identical sequences F7B8S1
ENSECAP00000019912 9796.ENSECAP00000019912 ENSECAP00000019912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]