SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020064 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020064
Domain Number 1 Region: 86-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.22e-16
Family Complement control module/SCR domain 0.00032
Further Details:      
 
Domain Number 2 Region: 148-210
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.27e-16
Family Complement control module/SCR domain 0.00026
Further Details:      
 
Domain Number 3 Region: 209-274
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000262
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 4 Region: 25-90
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000367
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 444-502
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000459
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 6 Region: 280-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000017
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 336-403
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000109
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020064   Gene: ENSECAG00000022571   Transcript: ENSECAT00000024165
Sequence length 539
Comment pep:novel chromosome:EquCab2:5:3424975:3460033:1 gene:ENSECAG00000022571 transcript:ENSECAT00000024165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWRVSEPTLFKVTLVAALFTTVLGDCGPPPDLPFASPVNKLIKTDFKTGTALKYTCHPGF
SRIGSSKITCNARGSWDYSVFCTKKRCRNPGDLINGRVEVKTDFLLGSTIEFSCSEGYIL
IGSTTSHCDIQDKGVDWSDPLPVCIIAKCEAPPAISNGKHSGGDEDIYTYGSSVTYSCDP
HFSMIGKASISCTVENKTIGVWSPSPPTCKHIVCRQPQVPNGIFVSGFGPLYTYKDTIVF
GCKKGYSLTGSSLIYCEADDNWDPPPPVCELSDCIDLPDIPHAFWNGIPYNLRNQEVFEI
GTVLQYQCEPGYSPIPDEPLNVTCQESLMWTPSKGCERICCPKPEATNIRITSEIDPIDR
CVYGGYEDDISYTCDEGFYPASLHGKSSCQEDGKWKPVPACKRPMKLDNNHSFSRLSNLE
ESKVTSRKSYLAHDENSINNSKKTTCMKPEIKNGKLSEDKDEYVTPENVAIQCDPGYSLV
GSQSIKCSEKRTWDPEVPKCEQEVPEVCEQVLPGRHIMQCLPSPQDVKMALQVIKVSLD
Download sequence
Identical sequences F6ZD61
ENSECAP00000020064 ENSECAP00000020064 9796.ENSECAP00000020064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]