SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020093 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020093
Domain Number 1 Region: 36-81
Classification Level Classification E-value
Superfamily Elafin-like 0.0000209
Family Elafin-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020093   Gene: ENSECAG00000022689   Transcript: ENSECAT00000024197
Sequence length 81
Comment pep:novel chromosome:EquCab2:22:34626788:34627928:-1 gene:ENSECAG00000022689 transcript:ENSECAT00000024197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKWLVLQLLTLYCLGILPASGNWKERIDSLVEFPIYIFPKLKLKPCPKIPTDEHCVTNCQ
LHSECQIGHRCCRAFCGNVCM
Download sequence
Identical sequences F7BS12
ENSECAP00000020093 9796.ENSECAP00000020093 ENSECAP00000020093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]