SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020140 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020140
Domain Number 1 Region: 317-566
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.64e-86
Family STAT DNA-binding domain 0.000000682
Further Details:      
 
Domain Number 2 Region: 139-316
Classification Level Classification E-value
Superfamily STAT 1.04e-45
Family STAT 0.00012
Further Details:      
 
Domain Number 3 Region: 567-684
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-39
Family SH2 domain 0.0000294
Further Details:      
 
Domain Number 4 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 9.42e-31
Family Transcription factor STAT-4 N-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020140   Gene: ENSECAG00000022326   Transcript: ENSECAT00000024249
Sequence length 849
Comment pep:known_by_projection chromosome:EquCab2:6:73982635:73993353:-1 gene:ENSECAG00000022326 transcript:ENSECAT00000024249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLDSPFQDQLYELYSNILLPMDIRQHLAVWIEDQNWKEAVLGNDDSKANMLF
FHFLDQLTSECGRCSQDPECLLLRHKLRKFYRDIQAFPQGPTQLAEMIFNLLLEEKRILI
QAQKAQLEQEEPALEAPVESQQHEIESRILELRAMMEKLVKSISQLKDQQDVFLFRYNTS
VSMKTPSSDPRQIRQQQLLQETLNELDKRRKEVLDDSKALLGRLTTLVELLLPKLEEWKV
QQQKACIGGPMHGGLEQLENWFTAGAKLLFHLRQLLKELKGLSHLVSYQEDPLHKGVDLQ
KAQVTELLQCLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTAE
VSIDRNPPQTQGFRKFNILTSSQKTLTPEKGQSQGLIWDFSYLSLVEQRSCSGKGSNKGL
LGVTEELHIISFTVRYAYQGLKQELKTDCLPVVIISNMNQLSIAWASVLWFNLLSSNPQN
QQFFSSPPKAPWSLLGPALSWQFLSYVGRGLDQDQLSMLRNKLFGQNCKTEDASLSWADF
TKRESPPGKLPFWTWLDKILDLVHDHLKDLWNDGRIMGFVSRSQERRLLKKTVSGTFLLR
FSETSEGGITCSWVEHQDDDKVLIYSVQPFTKEVLQSLPLTKIIRHYQLLTEENIPENPL
CFLYPRIPRDEAFGRYYQETVNLEEQRKYLKHRLIMVSNRQVDELQQLPEFKLDPDMESS
ELDQGLAPGPAPELGLGLEQLLEAGLDLEPMLDSTLAAVSGVPEPNLGPELKLEPILERI
SQSEPEPDLPHDLMHLNTEEMEIFRNSTKIEEIMPNGDPLLAGQNTEDEAYIFHPSHFYT
EGPLIPSDY
Download sequence
Identical sequences F6U1D9
ENSECAP00000020140 ENSECAP00000020140 9796.ENSECAP00000020140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]