SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020227 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000020227
Domain Number - Region: 43-77
Classification Level Classification E-value
Superfamily Elafin-like 0.000116
Family Elafin-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020227   Gene: ENSECAG00000022829   Transcript: ENSECAT00000024355
Sequence length 79
Comment pep:known_by_projection chromosome:EquCab2:22:34650890:34652033:1 gene:ENSECAG00000022829 transcript:ENSECAT00000024355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTQALLPLLLLCVLLLQAQGGVRKRRSTKKTQLPREIKICEKPVNIHMCRRPCAYDKEC
QANNICCSTFCRNICMNIL
Download sequence
Identical sequences F6UQE4
ENSECAP00000020227 9796.ENSECAP00000020227 ENSECAP00000020227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]