SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020234 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000020234
Domain Number - Region: 42-71
Classification Level Classification E-value
Superfamily Elafin-like 0.000183
Family Elafin-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020234   Gene: ENSECAG00000022835   Transcript: ENSECAT00000024363
Sequence length 71
Comment pep:known_by_projection chromosome:EquCab2:22:34684049:34686724:1 gene:ENSECAG00000022835 transcript:ENSECAT00000024363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPVLLLQSLLLIHLTPQLVPGSPKQHFMKYILEPPPCRSAPEECTQFCTLQEDCPKGLQ
CCSAFCGIICT
Download sequence
Identical sequences F6UQ74
9796.ENSECAP00000020234 ENSECAP00000020234 ENSECAP00000020234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]