SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020313 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020313
Domain Number 1 Region: 348-536
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.21e-66
Family Regulator of G-protein signaling, RGS 0.00000723
Further Details:      
 
Domain Number 2 Region: 741-970
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-64
Family DBL homology domain (DH-domain) 0.000000000724
Further Details:      
 
Domain Number 3 Region: 974-1106
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-38
Family Pleckstrin-homology domain (PH domain) 0.00000131
Further Details:      
 
Domain Number 4 Region: 51-132
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-19
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020313   Gene: ENSECAG00000022702   Transcript: ENSECAT00000024454
Sequence length 1117
Comment pep:known_by_projection chromosome:EquCab2:7:27989462:28052153:1 gene:ENSECAG00000022702 transcript:ENSECAT00000024454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHGSILNRESPTDKKQKVERSASHDFDPTDSSSKKTKSSSEESRSEIYGLVQRCVIIQKD
DNGFGLTVSGDNPVFVQSVKEMDGAAMRAGVQTGDRIIKVNGTLVTHSNHLEVVKLIKSG
SYVALTVQGRPPGSPQIPLADSEVEPSVIGHMSPIMTSPHSPGASGNMERITSPVLMGEE
NNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQEAKKHIPQLQEQLSKAT
GSAQPLGDALTVSEVEADPGDGLGRIDYSSGDVSRHSSDNADSPKSGLKERIYLEETEKS
EVNQDIDTQSLIGSPSTRIAPHIIGAEDDDFGTEHEQDKPQLINGQCSCFQSIELLKSRP
AHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRRVFLEFHQFFLDRSAHLKVSVPD
EISVDLDKRRPELIPEDLHRHYIQTMQEKVHPEVQRHLEDFRQKRSMGLTLAESELTKLD
AERDKDRVTLEKERACAEQIVAKIEEVLMTAQAVEEDKSSTMQYVILMYMKHLGVKVKEP
RNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSILGPPRRPSRHDNSAICRAMELQ
KQRHPKHLSTPSSVSPEPQDPAKLRQSGLASEGADAGYLPANSTGATFQGKQPGKVVKGR
SKQVGETPTSGDSLDGTPRTPNTIFDFPPPPLDQVQEEEWEVERVTEHETPKPFRKFDSI
AFGESQSEDEQFENDLETDPPNWQQLVSREVLLGLKPCEIKRQEVINELFYTERAHVRTL
KVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHIGLNEQMKSVRKRNETSVIDQIGE
DLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFQTFVQDAESNPLCRRLQL
KDIIPTQMQRLTKYPLLLDNIAKYTEWPMEREKVKKAADHCRQILNYVNQAVKEAENKQR
LEDYQRRLDTSNLKLSEYPNVEELRNLDLTKRKMIHEGPLVWKVNRDKTIDLYTLLLDDI
LVLLQKQDDRLVLRCHSKILASTADSKHTFSPVIKLNTVLVRQVATGEDNKALFVISMSD
NGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTRP
Download sequence
Identical sequences F6WE69
ENSECAP00000020313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]