SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020315 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000020315
Domain Number - Region: 128-182
Classification Level Classification E-value
Superfamily SEA domain 0.0183
Family SEA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020315   Gene: ENSECAG00000022902   Transcript: ENSECAT00000024457
Sequence length 217
Comment pep:known_by_projection chromosome:EquCab2:19:45513813:45534052:-1 gene:ENSECAG00000022902 transcript:ENSECAT00000024457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FMEGARPPSPGDELELSVLEGQPDEQTPLNGAVGTITSPEEPYPAQANKESPWSSCNKNL
IGRCKLWMVITSIFLGLILVIVVSLCLIGVTYIDEDENEILELSSNKTFLVRLKIPEECV
SEEELPHLLTKRLTDVYSSSPSLSRYFTSVEIVDFSGENATITYHLQFGVPSEDDGFMKY
MMSQELVLGVLLQNFHDQNVSGCETLGLDPASLLLFG
Download sequence
Identical sequences F6WE48
ENSECAP00000020315 9796.ENSECAP00000020315 ENSECAP00000020315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]