SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020318 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020318
Domain Number 1 Region: 186-329
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 82-187
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-36
Family Second domain of FERM 0.000000883
Further Details:      
 
Domain Number 3 Region: 1-81
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-25
Family First domain of FERM 0.00000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020318   Gene: ENSECAG00000022255   Transcript: ENSECAT00000024460
Sequence length 646
Comment pep:known_by_projection chromosome:EquCab2:2:27099897:27271085:-1 gene:ENSECAG00000022255 transcript:ENSECAT00000024460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHCKVSLLDDTVYECVVEKHAKGQDLHKRVCEHLNLLEEDYFGLAIWDNTTSKTWLDPAK
EIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLG
SYTVQSELGDYDPELHGADYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLEN
AKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFI
KIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRY
SGRTQAQTRQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAIAQSQV
TEGAPVKKAGKETAEAEVKGEEVPPEQAEPEPTEVQKVEKTHIEVTVPTSNGDQTQKLAE
KTEDLIRMRKKKRERLDGENIYIRHSNLMLEDLGKSQEEIKKHHASISELKKNFMESVPE
PRPSEWDKRLSTHSPFRTPNINGQIPTGEGPPLVKTQTVTISDTANAVKSEIPTKDVPIV
HTETKTITYEAAQTDDSNGDLDPGVLLSAQTITSETTSSTTTTQITKTVKGGISETRIEK
RIVITGDADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEISEE
Download sequence
Identical sequences F6WE07
ENSECAP00000020318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]