SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020357 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020357
Domain Number 1 Region: 77-115
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000693
Family Elafin-like 0.002
Further Details:      
 
Domain Number 2 Region: 33-70
Classification Level Classification E-value
Superfamily Elafin-like 0.00000327
Family Elafin-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020357   Gene: ENSECAG00000022949   Transcript: ENSECAT00000024502
Sequence length 116
Comment pep:known_by_projection chromosome:EquCab2:22:34757797:34760986:-1 gene:ENSECAG00000022949 transcript:ENSECAT00000024502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVSLLIMSSCFFLMKALLVLGSLASWVTAGKHEFAECPADPNPCENLCDGDSSCPQGHKC
CSTGCGRICRGDIEGGRDGECPQVFLGLCIFNCVSDANCEAGEKCCKSGCGRFCVP
Download sequence
Identical sequences F6W0D2
9796.ENSECAP00000020357 ENSECAP00000020357 ENSECAP00000020357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]