SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020392 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020392
Domain Number 1 Region: 9-46
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000497
Family Elafin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020392   Gene: ENSECAG00000022988   Transcript: ENSECAT00000024541
Sequence length 46
Comment pep:novel chromosome:EquCab2:11:37135124:37139027:-1 gene:ENSECAG00000022988 transcript:ENSECAT00000024541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVERKHPLGGSRPGRCPTVPPGTFGHCAELCTGDASCPKGQKCCSN
Download sequence
Identical sequences F6VSH5
ENSECAP00000020392 ENSECAP00000020392 9796.ENSECAP00000020392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]