SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020447 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020447
Domain Number 1 Region: 82-154
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000445
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 2 Region: 151-213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000106
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 3 Region: 20-90
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000126
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000020447
Domain Number - Region: 285-314
Classification Level Classification E-value
Superfamily Notch domain 0.00418
Family Notch domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020447   Gene: ENSECAG00000023026   Transcript: ENSECAT00000024604
Sequence length 324
Comment pep:known chromosome:EquCab2:25:20806816:20843213:1 gene:ENSECAG00000023026 transcript:ENSECAT00000024604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTVTCAEGKWNKQVACEPVDCGIPDQHHVYAASFSCLEGTTFGSKCSFQCRHPAQLKGNN
SLLTCMEDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVP
GSSRKSKKRAFKTQCTQDGSWQDGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCED
NSENNVIHCRKDGTWSGSFHVCQEMQGQCSAPDQLNSNLKLQCPQGYAIGSECATSCLDH
NSESIILPMNVTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDA
INNRAFCNYDGGDCCASTVKTKKV
Download sequence
Identical sequences F6UNF7
ENSECAP00000020447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]