SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020520 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020520
Domain Number 1 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020520   Gene: ENSECAG00000023102   Transcript: ENSECAT00000024688
Sequence length 143
Comment pep:novel chromosome:EquCab2:10:22239597:22246657:-1 gene:ENSECAG00000023102 transcript:ENSECAT00000024688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTFKDVTIEFSQEEWECLDPAQRALYRDVMLENCRNLLSLEMSLFGLSIISILEHGKEPW
TVQSQVKIVKKLSGWECIKGVNRGKSLARRKGSRTKEIPKKLGLSFQSHLAELQRFQTKE
KIYECNQVEKSIKMYSLISPLQR
Download sequence
Identical sequences F6TJN6
ENSECAP00000020520 9796.ENSECAP00000020520 ENSECAP00000020520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]